KEGG   Bacillus anthracis A0248: BAA_3442Help
Entry
BAA_3442          CDS       T00892                                 

Gene name
dxr1
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bai  Bacillus anthracis A0248
Pathway
bai00900  Terpenoid backbone biosynthesis
bai01100  Metabolic pathways
bai01110  Biosynthesis of secondary metabolites
bai01130  Biosynthesis of antibiotics
Module
bai_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bai00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BAA_3442 (dxr1)
Enzymes [BR:bai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BAA_3442 (dxr1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ACQ48658
Position
3133663..3134820
Genome map
AA seq 385 aa AA seqDB search
MVKYISILGSTGSIGTSALDVVSAHPEHFKIVGLTANYNIELLEQQIKTFQPRIVSVATK
ELADTLRTRISTNTKITYGTDGLIAVATHPNSNLVLSSVVGVSGLLPTIEALKAKKDIAI
ANKETLVAAGHIVTELAKQNGCRLIPVDSEHSAIFQCLNGENNKEIDKLIVTASGGAFRD
KTREEMKTLQAKDALKHPNWLMGAKLTIDSATLMNKGFEVMEARWLFDIPYEKINVMIHK
ESIIHSLVEFIDGSVIAQLGAPDMRMPIQYAFHYPTRLPSSYEKLNLLEIGSLHFEKPDL
EKFPCLQYAYECGKIGGITPAVLNAANEIANALFLKNEIAFFDIEKTIYKTVEAHHNVKD
PSLDAILEADQWARQYANQLLIKKS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaatatatatccattttaggttcaacaggatccatcggcacatcggcattagat
gtcgtttcagctcatcccgaacattttaaaatcgtcggtttaaccgcaaattataatatc
gagcttcttgaacaacaaatcaaaacgtttcaacctcgcattgtaagcgtcgcgacaaaa
gaattagcagacacgcttcgtacgcgtatttcaaccaacacaaaaatcacatacggaaca
gatggcttaattgcagtagctactcaccctaattcaaatcttgtattaagttccgtcgtt
ggtgtttcaggattactcccaacaattgaagcattaaaagcgaagaaagatattgccatc
gctaataaagaaacgttagttgcagctggtcatattgtaactgaactggccaaacaaaac
ggatgtcgtttaattccagtcgatagcgaacattcagctattttccaatgtttaaacgga
gaaaataataaagaaattgacaaattaatcgttacagcttctggcggtgcattccgtgat
aaaacacgtgaagaaatgaaaactctacaagcaaaagatgctttaaagcacccaaactgg
ttaatgggggcaaaactaacgattgattctgccacgttaatgaataaaggatttgaagta
atggaagcgagatggttatttgatattccttatgaaaaaattaatgtaatgattcataaa
gaaagcattattcattctttagtagagtttatcgatggatcagttatagcacagctcggt
gctcctgatatgaggatgccgattcaatatgcgtttcactaccctactcggctgccttct
tcctatgaaaaattaaatttattagaaatcggtagtttacattttgaaaaaccagattta
gagaagtttccttgtctacaatacgcatatgaatgtggcaaaattggtggtattactcct
gctgtattaaacgcagcaaatgaaattgcgaatgcactattcttaaaaaatgaaattgcc
tttttcgatattgaaaaaacaatttacaaaacagttgaagcccatcataacgtaaaagat
ccttcactagatgctatattagaagcggatcaatgggcacgccaatatgcaaatcaattg
ttaataaaaaagagctaa

DBGET integrated database retrieval system