KEGG   Bacillus anthracis A0248: BAA_3581Help
Entry
BAA_3581          CDS       T00892                                 

Gene name
amyS
Definition
cytoplasmic alpha-amylase (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
bai  Bacillus anthracis A0248
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bai00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3255367..3256908)
Genome map
AA seq 513 aa AA seqDB search
MFKKITIVGLSVVLFLPSIYGESKVYADTINNGTLMQYFEWYAPSDRNHWNRLRTDAENL
AQKGITSVWIPPAYKGTTQNDVGYGAYDLYDLGEFNQKGTVRTKYGTKAQLKSAIEALHK
QNIDVYGDVVMNHKGGADYTETVTAVEVDRNNRNVEVSGDYEISAWTGFNFPGRGDNYSN
FKWKWYHFDGTDWDEGRKLNRIYKFRGIGKAWDWEVSSENGNYDYLMYADLDFDHPDVAN
EMKNWGTWYANELNLDGFRLDAVKHIDHEYLRDWVNHVRQQTGKEMFTVAEYWQNDIQTL
NNYLAKVNYNQSVFDAPLHYNFHYASKGNGNYDMRNILNGTVMQNHPALAVTLVENHDSQ
PGQSLESVVSPWFKPLAYAFILTRAEGYPSVFYGDYYGTSGNSSYEIPALKDKIDPILTA
RKNFAYGTQRDYLDHPDVIGWTREGDSVHANSGLATLISDGPGGSKWMDVGKNNAGEVWH
DMTGNQTNTVTINKDGWGQFHVSGGSVSIYVQQ
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaaaaataacaatagtcggcttgtcggttgttttgtttttacctagtatatat
ggggagagtaaagtgtatgcagatacgattaacaatggaacgttaatgcagtattttgag
tggtatgctccaagtgataggaatcattggaatcgtttgcgcactgatgctgaaaattta
gcgcaaaaaggaattacatctgtttggatacctcctgcgtataaaggaactacgcaaaat
gatgtaggatatggagcatatgatttatatgatttgggtgaattcaatcaaaagggaaca
gtgcggacgaaatatgggacaaaagcacaattgaaatctgcaattgaagctttacataag
caaaacatcgatgtatacggcgatgtagttatgaatcataaaggtggagcagattatact
gaaactgtaacagctgttgaggtagaccgtaacaatcgaaatgttgaggtatcaggtgat
tatgaaattagtgcatggacagggtttaactttcctggacgtggagataattattctaat
ttcaaatggaagtggtatcattttgacggaacggattgggatgaaggaaggaaattaaat
cgaatttataaatttaggggtataggtaaagcatgggactgggaagtgtctagtgagaat
ggaaattatgattatttgatgtatgcagaccttgattttgatcatccagatgttgcgaat
gagatgaaaaattgggggacgtggtatgcgaatgaattaaatttagatggctttcgttta
gatgctgttaaacatattgatcatgaatatttacgcgattgggtaaatcatgttaggcag
caaacggggaaagaaatgtttacggtggctgaatattggcaaaatgatatccaaacttta
aataattatttagcgaaagtcaattataatcaatctgtatttgatgcaccactgcattac
aattttcattatgcttcaaaaggaaatgggaattatgatatgagaaatattttaaatgga
acagtaatgcaaaatcatcctgcactcgcagttactcttgttgagaatcatgattctcag
cctggtcagtcattggaatctgtagtaagtccgtggtttaaaccgttggcatatgcattt
attttaactcgtgcagagggatatccttcagttttttatggtgattactatgggacaagc
ggaaatagtagttatgaaattccagcgttaaaagataaaattgatccgattttgacagca
cgaaaaaactttgcatatggtacgcagcgtgattatttagaccatccagatgtgattgga
tggacgagagaaggtgatagtgtacatgctaattctggtttagcaacattaatctctgat
ggaccgggaggatcaaagtggatggatgttggaaagaataatgcaggggaagtatggcat
gatatgacgggtaatcaaacaaatactgtaacaattaataaggatggatgggggcaattc
catgtaagtggaggatcagtttccatatatgttcagcagtga

DBGET integrated database retrieval system