KEGG   Bacillus anthracis A0248: BAA_3595Help
Entry
BAA_3595          CDS       T00892                                 

Definition
oxidoreductase, zinc-binding dehydrogenase family
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bai  Bacillus anthracis A0248
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bai00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BAA_3595
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAA_3595
  Lipid metabolism
   00071 Fatty acid degradation
    BAA_3595
  Amino acid metabolism
   00350 Tyrosine metabolism
    BAA_3595
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BAA_3595
   00626 Naphthalene degradation
    BAA_3595
Enzymes [BR:bai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BAA_3595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3271055..3272053
Genome map
AA seq 332 aa AA seqDB search
MKAMIIDKYGKVPMRMAEVPIPEINEHEVLAEIHAASINPIDFKIRDGKVKMLLKYEMPL
ILGNDFAGVIIKVGSKVTRFKIGDEIYARPRKNKIGTFAEYIAIHEDDIALKPKNLSFEE
AASIPLVGLTSYQALHDIMQLQKDQKILIHAGSGGVGTFAIQLAKIMGATVTTTASEAGP
DLVKSLGADQIINYKTEKFEEILKDYDAVFDTIGGTTLEKSFDIIKSGGNIVSVSGIPNA
RFSKEFGSGFFKTFLFSLASKKLTALEKKHNAQYSFLFMKPSGDQLRTIANYIEAGKIKP
VIDRVFPFEDAQKAMEYSEAGRAKGKIIVKMK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgatgataattgataagtatggaaaagtcccaatgcgtatggccgaggtacct
attcctgaaataaatgagcatgaagtgctcgcagaaattcatgcagctagtattaaccca
attgattttaaaatacgcgatggaaaagtaaagatgttactgaaatatgaaatgccccta
atccttgggaatgactttgccggtgtcatcataaaggttggatcaaaagtaactcgtttt
aaaatcggtgatgaaatatatgcacgtccaagaaaaaataagattggtactttcgcggag
tatatagctattcatgaagatgatatagctttaaaaccgaaaaatttaagttttgaagaa
gctgcttcaattccacttgttggcttaacatcatatcaagcattacatgacattatgcaa
ttacaaaaagatcaaaagattttaattcacgctggatctggtggtgttggtactttcgca
attcagctagcaaaaataatgggtgctaccgttacaacaactgctagtgaagctggtccc
gatttagtaaagtctcttggagcagatcaaattattaattacaaaacagaaaaatttgaa
gaaatactaaaagattatgatgcagtatttgataccattggtggtacaacacttgaaaaa
tcattcgatattataaaaagcggcggcaacattgtttccgtttcaggaataccaaatgct
cgtttcagtaaagaatttggttctggattttttaaaacattcttattttcattagcaagt
aaaaaacttactgcacttgaaaaaaagcataatgctcaatattcatttttatttatgaag
ccaagcggagatcaattacgtactatcgcaaactatattgaagccggaaaaatcaaaccg
gtaatcgatcgagttttcccttttgaagatgcgcaaaaagcaatggaatattcagaggcc
ggaagagcaaaaggaaaaataattgtgaaaatgaaataa

DBGET integrated database retrieval system