KEGG   Bacillus anthracis A0248: BAA_4270Help
Entry
BAA_4270          CDS       T00892                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bai  Bacillus anthracis A0248
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bai00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BAA_4270
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BAA_4270
Enzymes [BR:bai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BAA_4270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3887257..3888033
Genome map
AA seq 258 aa AA seqDB search
MVTNRVVFLTGAASGIGYEMGNTFAKEGAKVVITDRLEERAKEAAEQLQKEGFQAIGLKC
DVTSEEEIEASISQTVNHFGSLDILINNAGMQHVSPIEDFPTEKFELLIKIMQIAPFIAI
KHAFPIMKKQKYGRIINVASINGLVGFAGKAAYNSAKHGVIGLTKVAALEGATHGITVNA
LCPGYVDTPLVRNQLQDLATTRNVPLENVLEDVIYPLVPQKRLLQVQEIADYAMFLASEK
AKGITGQAVVIDGGYTAQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggttacaaatcgagttgtttttttaacaggtgctgcaagtggtattggatatgaaatg
ggaaacacttttgcaaaagaaggtgcaaaagttgttattaccgatcgtcttgaagaacgt
gcaaaagaagctgctgaacaactacaaaaagagggctttcaagctatcggcttaaaatgt
gatgttacatccgaagaagaaatagaagcatccatttcccaaactgttaatcatttcggt
tcattagacatattaattaataacgcaggaatgcaacacgtttcaccaattgaagatttc
ccaaccgaaaaattcgagctactaattaaaattatgcaaatcgctccttttatcgccatt
aagcatgcctttcccattatgaaaaagcaaaaatatggccgaattattaatgtagcttcc
attaatggcctcgttggattcgctggaaaagctgcttataatagcgcaaaacatggcgta
attggattaacaaaagttgccgctttagaaggggctactcacggaattactgttaatgca
ctttgtcccggttatgtcgatacccctctcgtacggaatcaattacaagacttggccacc
acacgaaatgtaccacttgaaaatgttttagaggatgtcatttatccacttgtcccacaa
aaacgcttattacaagtacaagagattgctgattatgcgatgtttttagcgagcgaaaaa
gcgaaaggtataactggacaagctgtcgttatcgatggtggttataccgctcaataa

DBGET integrated database retrieval system