KEGG   Bacillus anthracis A0248: BAA_4855Help
Entry
BAA_4855          CDS       T00892                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bai  Bacillus anthracis A0248
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAA_4855 (pfkA)
   01230 Biosynthesis of amino acids
    BAA_4855 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAA_4855 (pfkA)
   00030 Pentose phosphate pathway
    BAA_4855 (pfkA)
   00051 Fructose and mannose metabolism
    BAA_4855 (pfkA)
   00052 Galactose metabolism
    BAA_4855 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BAA_4855 (pfkA)
Enzymes [BR:bai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BAA_4855 (pfkA)
Protein phosphatases and associated proteins [BR:bai01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BAA_4855 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4408027..4408986)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHDIEVYGIYHGYAGLISGHIEKLELGSVGDI
IHRGGTKLYTARCPEFKDPEVRLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEQGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLADGAETILIPEEEYDMEDVIARLKRGSERGKKHSIIVVAEGVGSAIDIGKHIEEATNF
DTRVTVLGHVQRGGSPSAQDRVLASRLGARAVELLIAGKGGRCVGIQDNKLVDHDIIEAL
AQKHTIDKDMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattggtgtattaacaagtggtggagattcacctggtatgaatgctgccatt
cgtgcagttgttcgtaaagcgattttccatgatattgaagtatatggtatttaccatgga
tacgctggattaatttctggtcacattgaaaaattagaactaggttctgttggcgatatt
atccaccgcggtggtacgaaattatatacagcaagatgtcctgagtttaaagacccagaa
gtacgactaaaaggtatcgagcaattaaagaaacacggtatcgaaggacttgttgttatt
ggtggagatggttcttaccaaggcgctaaaaaattaactgaacaaggattcccttgtgtt
ggtgtaccaggtacaattgacaatgatatccctggaacagacttcacaattggtttcgat
acagctttaaacactgttattgatgcaattgataaaattcgtgacacagctacatctcat
gaacgtacatatgttatcgaagtaatgggacgtcacgctggtgatatcgcattatgggct
ggtttagctgatggtgcagaaacaatcttaattccagaagaagagtatgacatggaagat
gttatcgctcgtctgaagcgcggtagtgaacgtggtaaaaaacacagtattatcgttgta
gctgaaggtgttggaagtgcaattgacatcggtaagcacattgaagaagcaacaaacttt
gatactcgcgtaactgtattaggtcacgtacaacgtggtggatcaccaagtgcacaagac
cgtgtattagcaagccgtcttggcgcaagagcagttgaattattaattgctggtaaaggt
ggacgttgtgtaggtattcaagataacaaacttgttgatcatgacattatcgaagcgtta
gctcaaaagcatacaatcgataaagatatgtatcaattatctaaagaattatccatctaa

DBGET integrated database retrieval system