KEGG   Bacillus anthracis A0248: BAA_5239Help
Entry
BAA_5239          CDS       T00892                                 

Definition
putative phosphoglycerate mutase family protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bai  Bacillus anthracis A0248
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAA_5239
   01230 Biosynthesis of amino acids
    BAA_5239
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAA_5239
  Energy metabolism
   00680 Methane metabolism
    BAA_5239
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAA_5239
Enzymes [BR:bai01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BAA_5239
Exosome [BR:bai04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BAA_5239
  Exosomal proteins of melanoma cells
   BAA_5239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4722845..4723399
Genome map
AA seq 184 aa AA seqDB search
MKKIIVIRHCSATGQERDAELTTDGKKQANTLATFLLEHHPQIDHIISSPFVRAIDSIRP
YARQANLSIQEDERLAERILSDVPMDDWMQKLESTFTNIDIAFSGGESTKQATDRAISLI
QHVLKLNYTTTLLVTHGNLLTLILKYFDHTIGFHEWKALTNPDVYEIVIDEQCTIKRLWE
ASSK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattattgtcatacgacattgttcagcaactggccaagaacgtgatgccgaa
ttaacgaccgatggaaaaaaacaagcaaacacccttgctacattcctcttagagcaccat
ccacaaatagaccatattatttcaagcccatttgtgcgagctatcgattctattcggccc
tatgcacgccaagccaatttgtctatccaagaagatgaacgattagctgaacgcatatta
agcgacgttccaatggacgattggatgcaaaaactagaatctacttttacaaatatagat
attgccttttcaggcggggagtcaacgaaacaagcaacggatcgtgctatatcgcttatc
caacacgttttaaaattaaactatactacaacactacttgttacacatggcaatttactt
acactcattttaaagtactttgatcatacgattggctttcatgaatggaaagctttaacg
aatcctgatgtttacgaaattgtaattgatgaacaatgtactataaaacgattatgggaa
gcatcatccaagtaa

DBGET integrated database retrieval system