KEGG   Bacillus anthracis A0248: BAA_5366Help
Entry
BAA_5366          CDS       T00892                                 

Gene name
estA
Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bai  Bacillus anthracis A0248
Brite
Enzymes [BR:bai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BAA_5366 (estA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4838174..4838917)
Genome map
AA seq 247 aa AA seqDB search
MMKLASPKPFTFEGGDRAVLLLHGFTGNSADVRMLGRFLEKKGYTCHAPIYKGHGVPPEE
LVHTGPEDWWQDVTEAYQLLKDKGFEKIAVVGLSLGGVFSLKLGYTVPVLGVVPMCAPMY
IKSEETMYQGILAYAREYKKREQKSPEQIEQEMLEFQKTPMNTLKALQQLIADVRNNVDM
IYVPTFVVQARHDEMINTDSANIIYNGVESTLKDIKWYEDSTHVITLDKQRDELHEDVYN
FLEQLDW
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaattagcatctccgaaaccatttacatttgagggtggagaccgcgctgtttta
ttactacatggattcacaggaaactcagctgatgtacgtatgttagggcgtttcttagaa
aagaaaggctacacttgtcatgcgccaatttataaagggcacggtgtcccaccagaagag
cttgttcatacaggtcctgaagattggtggcaagacgtaacagaggcatatcagctttta
aaagataaaggttttgagaaaattgctgtcgttggattgtcacttggcggagtattttct
ctaaaattaggttatacagtaccggttttaggtgtagtaccaatgtgtgcaccgatgtat
attaagagtgaagaaacgatgtaccaaggtatattggcatatgcccgcgaatataaaaag
cgagagcaaaaatcaccagagcaaatcgaacaagaaatgttggaattccaaaagacaccg
atgaatacattaaaagcattacaacaattaattgctgacgtacgtaacaatgtggacatg
atttatgtaccaacatttgttgtacaagcgcgtcatgatgaaatgattaatacagatagt
gcgaacattatttataacggtgtagaatcaacgttaaaagacattaaatggtatgaagac
tctacgcatgtcattacacttgataagcagcgtgacgagctacatgaggatgtatataac
ttcttggagcaactagattggtaa

DBGET integrated database retrieval system