KEGG   Bacillus anthracis A0248: BAA_A0128Help
Entry
BAA_A0128         CDS       T00892                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bai  Bacillus anthracis A0248
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bai00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BAA_A0128
   00052 Galactose metabolism
    BAA_A0128
   00500 Starch and sucrose metabolism
    BAA_A0128
   00520 Amino sugar and nucleotide sugar metabolism
    BAA_A0128
Enzymes [BR:bai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BAA_A0128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pXO1:112831..113718
Genome map
AA seq 295 aa AA seqDB search
MKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVSSGIEDIIIVSGRGK
HVIEDHFDKSYELEQTLFKKNKIKTLEDIECISNLANIHYIRQKEPKGLGHAIYCARRFI
GEEPFAVLLGDDIVSSTYPCLKQLIDVYEEHHCSVVGVQRVLETEVSKYGIVKSANQNVN
QSIIPISMLVEKPPLETAPSNLAIMGRYILKPDIFEVLKNLPVGSGGEIQLTDAINVLNK
QQKVLAFEFDGKRYDVGDKFGFIKATIDFALQRESLKEDVLSYLRNITRDKLINK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtgaagattagaaaagcgattatcccagcagcgggattaggcacaagatttttacccgca
acaaaagcacaacctaaagaaatgttgccaattgtagataagccaactattcaatatatt
gttgaagaagctgttagctcaggaatagaggatattattattgtaagtgggagagggaag
catgttatagaagatcattttgataaatcttatgagctagaacaaactttatttaagaaa
aacaaaataaagactcttgaagacattgaatgcatttctaatttagcgaatatccattat
attcggcaaaaagaacctaaaggattaggacatgctatatattgtgctagacgttttata
ggtgaagaaccttttgcagttttacttggtgatgatattgttagctctacgtatccatgt
ctcaagcaattgatagatgtttatgaggaacatcactgttcagtggtaggtgttcaaagg
gtattagaaacagaagtgtctaaatatggaatagttaaatcggcaaatcaaaatgttaat
caatctattattcctatttctatgctagttgaaaaaccacctctggaaactgcaccttca
aatttagctataatgggcagatatatactaaaaccagatatttttgaggtgttaaaaaat
ttacctgtcggatcaggtggagaaattcagttaaccgatgcaatcaatgttttaaataaa
caacaaaaagtactcgcctttgaatttgatgggaaaagatatgatgtaggggataaattt
ggctttattaaagcgactatagattttgcacttcagagagaaagtctaaaagaagatgtt
ttgagttatttgagaaatatcactcgagataaacttatcaataaataa

DBGET integrated database retrieval system