KEGG   Buchnera aphidicola (Cinara tujafilina): BCTU_060Help
Entry
BCTU_060          CDS       T01528                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
baj  Buchnera aphidicola (Cinara tujafilina)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:baj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCTU_060 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    BCTU_060 (dapE)
Enzymes [BR:baj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BCTU_060 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
68989..70122
Genome map
AA seq 377 aa AA seqDB search
MHSSTLKLAQELINIPSISPNDLGCQDILIQRLLRCGFTVELINLKDTKNFWAWKGVGGK
TLSFAGHTDVVPAGSIKKWNFPPFCATIKDGFLFGRGAADMKGALSAMVVAVEKFLIKKP
IYSGRISFLITSDEESSGKYGTKHVVSVLKNRKELIDYCIIGEPTSEYVLGDCIKNGRRG
SMSAKLTIYGVQGHIAYPHLAINPIHQSLPFLSELSKLSLDHGNSFFLPSQIQISNIQIS
KKYSSNMIPGSLNIEFNIRFNGILIDQKIQEIILELLKKYLLNYSIKWTIHAQPFYSNTN
FLSKIVSESIFFNNNIIPNVNTSGGTSDGRFICNIANEIIELGLENCTIHKINECISIKN
LHLLQKIYERILDNIFR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcattcttcaactttaaagcttgcgcaagaattaattaatattccatcgattagtcca
aatgatttaggttgtcaggatattttaattcaaagattattaagatgcggttttacggtc
gaattaatcaatttaaaagatactaaaaatttttgggcatggaagggggtcgggggaaaa
acattaagttttgcgggacatacagatgttgttccagctggatcaattaaaaaatggaat
tttcctccgttttgcgctaccataaaagatggatttttatttggtagaggggcagcggat
atgaagggagctttatctgctatggtagttgctgttgaaaaatttttaataaaaaaacca
atttattcaggtcgtatatcatttttaatcacttcagatgaagaatcctctggtaaatat
ggaactaaacatgtggtatcagttttaaaaaatagaaaagaattaatagattactgtatt
attggtgaaccgactagtgaatatgtattaggtgattgtattaaaaatggtcgtcgtggt
tctatgagtgctaaattaactatttatggtgtacaaggtcatatcgcatacccacattta
gctataaatcctattcatcaatcattacctttcttatctgaactatccaagttatcttta
gatcatggaaatagtttttttttaccatcgcaaatacaaatatctaatatccaaataagt
aaaaaatattctagtaatatgattcccggatctttaaatatagagtttaatatacgtttc
aatggtatattaatagatcaaaaaattcaggaaattattttagaattactaaaaaaatat
ttattaaattattccataaaatggactatacatgctcaacctttttattcgaatacaaat
tttttaagtaaaattgtttctgaaagtatattttttaataataatattataccaaatgtt
aatacctctggtggaacttctgatggccgttttatatgtaatattgcaaatgaaataata
gagttagggttagaaaattgtacaattcataaaatcaatgaatgtattagtataaaaaat
ttacatttattacaaaaaatatatgagcgaattttagataatatatttagataa

DBGET integrated database retrieval system