KEGG   Buchnera aphidicola (Cinara tujafilina): BCTU_060Help
Entry
BCTU_060          CDS       T01528                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
baj  Buchnera aphidicola (Cinara tujafilina)
Pathway
baj00300  Lysine biosynthesis
baj01100  Metabolic pathways
baj01120  Microbial metabolism in diverse environments
baj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:baj00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BCTU_060 (dapE)
Enzymes [BR:baj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BCTU_060 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AEH39652
UniProt: F7WZ02
Position
68989..70122
Genome map
AA seq 377 aa AA seqDB search
MHSSTLKLAQELINIPSISPNDLGCQDILIQRLLRCGFTVELINLKDTKNFWAWKGVGGK
TLSFAGHTDVVPAGSIKKWNFPPFCATIKDGFLFGRGAADMKGALSAMVVAVEKFLIKKP
IYSGRISFLITSDEESSGKYGTKHVVSVLKNRKELIDYCIIGEPTSEYVLGDCIKNGRRG
SMSAKLTIYGVQGHIAYPHLAINPIHQSLPFLSELSKLSLDHGNSFFLPSQIQISNIQIS
KKYSSNMIPGSLNIEFNIRFNGILIDQKIQEIILELLKKYLLNYSIKWTIHAQPFYSNTN
FLSKIVSESIFFNNNIIPNVNTSGGTSDGRFICNIANEIIELGLENCTIHKINECISIKN
LHLLQKIYERILDNIFR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcattcttcaactttaaagcttgcgcaagaattaattaatattccatcgattagtcca
aatgatttaggttgtcaggatattttaattcaaagattattaagatgcggttttacggtc
gaattaatcaatttaaaagatactaaaaatttttgggcatggaagggggtcgggggaaaa
acattaagttttgcgggacatacagatgttgttccagctggatcaattaaaaaatggaat
tttcctccgttttgcgctaccataaaagatggatttttatttggtagaggggcagcggat
atgaagggagctttatctgctatggtagttgctgttgaaaaatttttaataaaaaaacca
atttattcaggtcgtatatcatttttaatcacttcagatgaagaatcctctggtaaatat
ggaactaaacatgtggtatcagttttaaaaaatagaaaagaattaatagattactgtatt
attggtgaaccgactagtgaatatgtattaggtgattgtattaaaaatggtcgtcgtggt
tctatgagtgctaaattaactatttatggtgtacaaggtcatatcgcatacccacattta
gctataaatcctattcatcaatcattacctttcttatctgaactatccaagttatcttta
gatcatggaaatagtttttttttaccatcgcaaatacaaatatctaatatccaaataagt
aaaaaatattctagtaatatgattcccggatctttaaatatagagtttaatatacgtttc
aatggtatattaatagatcaaaaaattcaggaaattattttagaattactaaaaaaatat
ttattaaattattccataaaatggactatacatgctcaacctttttattcgaatacaaat
tttttaagtaaaattgtttctgaaagtatattttttaataataatattataccaaatgtt
aatacctctggtggaacttctgatggccgttttatatgtaatattgcaaatgaaataata
gagttagggttagaaaattgtacaattcataaaatcaatgaatgtattagtataaaaaat
ttacatttattacaaaaaatatatgagcgaattttagataatatatttagataa

DBGET integrated database retrieval system