KEGG   Buchnera aphidicola (Cinara tujafilina): BCTU_128Help
Entry
BCTU_128          CDS       T01528                                 

Gene name
thrc
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
baj  Buchnera aphidicola (Cinara tujafilina)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:baj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCTU_128 (thrc)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCTU_128 (thrc)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BCTU_128 (thrc)
Enzymes [BR:baj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BCTU_128 (thrc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(149393..150682)
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKDHHEEVNFTYAIKLGLGKKQGLFFPKTLPKFNTKKLEELTEMDFITRSANILS
YFISDEISLNDLTKNVKNAFSFKPPFLHIVEKNIACLELFHGPTLAFKDFGARFMANMLS
YWNNKDDEMTILTATSGDTGAAVAHAFYCMDNIRVVILFPKGKISTLQEKIILYIRKNIH
TIAIDGSFDDCQSLVKQAFNDKKLRNKIGLNSANSINISRLLAQICYYFEAFALIPNNQR
NNIIISVPCGNFGNLTAGLLAKAMGLPIKSFIAATNANDTIPRYLHNGIWKPNKTISTIS
NAMDISQPNNWPRVEELFSTQKWNLKSLGYGSVSDQETESTLKKLYHIGYISEPHAAIAY
RLLKKKLHPKDFGLFLGTAHPAKFQKTIEKILNIKLKRPNSLEKRAHLPNFSYHMKPNFL
KLKDFLFTL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatataatttaaaagatcatcatgaagaagtaaattttacttatgcaattaaa
ttaggtttaggaaaaaaacaaggattattttttcctaaaactttaccaaaatttaatact
aaaaaattagaagaactaacagaaatggattttattacccgaagtgcaaatattttatca
tattttatatcagatgaaatttcattaaatgatttaacaaaaaatgtaaaaaatgcattt
tcttttaaaccgccttttttacatatagtagaaaaaaatattgcttgtttagaattattt
catggtcccaccttagcttttaaagattttggcgctcgctttatggctaatatgttatca
tattggaataacaaagatgatgaaatgactattttaacagctacttcaggagatactggt
gcagctgttgctcatgcgttttattgtatggataatattcgtgtagtaattttatttcca
aaaggaaaaattagtacattgcaagaaaaaattattttgtacattaggaaaaatatccat
acaatagctattgatggaagctttgatgattgccaaagcctggtaaagcaagcttttaac
gataaaaaattacgaaacaaaattggtttaaattcagcaaattcaattaatattagtcgt
ttattagctcaaatatgttattattttgaagcttttgcgttaattcctaataatcaacga
aataacattataatttcagttccatgcggaaattttgggaatttaacagcaggattatta
gcaaaagctatgggattacccataaaatcatttattgccgctactaacgctaacgatacg
attccaagatatcttcataatggtatatggaaaccaaataaaactatctcaacaatttcc
aatgctatggacattagtcaacctaataattggcctagagtagaagaacttttttctacc
caaaaatggaatttaaaaagcttaggatatggtagcgtatctgatcaagaaacagaatct
acattaaaaaagttatatcatatcggatacatttcagaaccacatgcagcaattgcatac
agattactcaaaaaaaaattacatcctaaagattttgggttgtttttaggcacagcacat
cctgctaaatttcaaaaaacaatagaaaaaatattaaatatcaaattaaagcgccctaat
tcattagaaaaaagagctcatttaccaaacttttcttatcatatgaagccaaatttttta
aagttaaaagattttttattcacattataa

DBGET integrated database retrieval system