KEGG   Buchnera aphidicola (Cinara tujafilina): BCTU_136Help
Entry
BCTU_136          CDS       T01528                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
baj  Buchnera aphidicola (Cinara tujafilina)
Pathway
baj00010  Glycolysis / Gluconeogenesis
baj00020  Citrate cycle (TCA cycle)
baj00620  Pyruvate metabolism
baj01100  Metabolic pathways
baj01110  Biosynthesis of secondary metabolites
baj01120  Microbial metabolism in diverse environments
baj01130  Biosynthesis of antibiotics
baj01200  Carbon metabolism
Module
baj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:baj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCTU_136 (aceF)
   00020 Citrate cycle (TCA cycle)
    BCTU_136 (aceF)
   00620 Pyruvate metabolism
    BCTU_136 (aceF)
Enzymes [BR:baj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BCTU_136 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: AEH39725
UniProt: F7WZ71
Position
163797..165050
Genome map
AA seq 417 aa AA seqDB search
MDIEILTPDIGIEKVEVTEILVQEGIKIQKEDSIVSVESQKSVLEIPSPYAGIVKKFYIK
VGDFLTINTLLMTLHVNKSIIHNKNLLNKSNISQNNLSKSLKNIRSFNKNQENINIFKEQ
EKIYASPNIRRVSKILKINLLDIVGTGRNGRIIMEDLYKYQQLNTHNSIENISQKNILLH
EKNKKLKILNFFKLNKVQQIIGKNLINTWNNVPHVTQFDEADITELDQFRQCYNKKCIDK
KNNLSILPFLIKCIERSLYQFPNFNSSLTSCGTKIILKKKINIGIAVETDFGLLVPVLKN
LYYKSISCISLEIKNLVLKAKKNQLHISETQHGSFTVSNLGHLGGVGFTPIINFPEVCIL
GISKAVIKPVWKKKQFIPRLILPFSISYDHRVINGADAVRFTTFICDLLRDIRNLII
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtggatatagaaattttaactcctgatattggtattgaaaaagtagaagtaactgaaata
ctagtacaggaaggaataaaaatacaaaaagaagacagcattgtttcagtagaaagtcaa
aaatctgtccttgaaataccatcgccatacgcgggtattgtaaaaaaattttatattaaa
gttggtgattttttaacgattaatacattacttatgactttacatgttaataagagtatt
attcataataaaaatttattaaataaatcaaatatatcgcaaaataatttatctaaatct
ttaaaaaatattcgtagttttaataaaaatcaagagaatataaatatttttaaagaacaa
gaaaaaatttatgcttctcctaatattcgtcgggtgtcaaaaatattaaaaattaatttg
ttagatattgttggaactggtcgtaatggtcgaattattatggaggatttatataagtat
caacaattaaatacacataatagtatcgaaaatatttcacaaaaaaatattcttttgcat
gaaaaaaataaaaaattaaagatattaaatttttttaaattaaacaaagtacaacaaatt
ataggaaaaaatttaattaatacttggaataatgttccgcatgtaacgcaatttgatgag
gcagatattacagaattagatcaatttagacaatgttataataaaaagtgtattgataaa
aaaaataatttatcaatattaccttttcttattaaatgtattgaacgtagtttatatcaa
tttccaaattttaatagttctttaacttcatgtggaactaaaataatacttaaaaaaaaa
attaatattggcattgctgtggaaacagatttcgggttattagttccggttttaaaaaat
ttgtactataaatcaatatcctgtatttctttagaaattaaaaatttagttttaaaagca
aaaaaaaatcaattacatatatcagaaacgcaacatggtagtttcacagtatctaattta
ggacatcttggaggtgtggggtttacaccaattattaattttcccgaagtttgtatttta
ggtatatctaaagcagttattaaaccggtctggaaaaaaaagcaatttattccgcgtttg
atccttcctttttctatttcttatgatcatcgagttattaatggagcggatgcagtacgt
tttacgacatttatatgtgatcttttacgggatataagaaatttaataatataa

DBGET integrated database retrieval system