KEGG   Buchnera aphidicola (Cinara tujafilina): BCTU_180Help
Entry
BCTU_180          CDS       T01528                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
baj  Buchnera aphidicola (Cinara tujafilina)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:baj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCTU_180 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCTU_180 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCTU_180 (trpA)
Enzymes [BR:baj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BCTU_180 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(216744..217349)
Genome map
AA seq 201 aa AA seqDB search
MKSRYKILLKKLKLNKEGCFIPFIILGDPSIDVSLKIIDVLIQSGVDALELGIPFSDPIA
DGIIIQKAHLRSFFSKMTVKKCFLMLHIIRKKYPFIPIGLLVYMNIIFSYGISKFYAKCS
SIQIDSILIADMPYEESSDIRRTSKKYNIAQVFICPPDAETKIIKKISKYSQGYIYLLSR
SGTTGLQKTTIKFSLKKNDKN
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcacgatataaaattttattaaaaaaattaaaattaaataaagaagggtgtttt
attccatttataatattaggtgacccatctatagatgtatccttaaagattattgatgta
cttattcaaagtggtgttgatgctttagaattaggcattcctttttctgatcctattgca
gatggaattattatacaaaaagcacatttacgttctttttttagtaaaatgacagtaaaa
aaatgttttttaatgttacatattattagaaaaaaatatccgtttattccaattggactt
ttagtatacatgaatattattttttcttatggaatctcaaaattttatgctaaatgttct
tctatacaaatagattctatattaatagcagatatgccttatgaagaatctagtgatatt
cgacgtacctctaagaaatataatatcgctcaagtatttatttgccctcctgatgctgaa
acaaaaataattaaaaaaatatcaaaatatagtcaaggatatatatatctattatcaaga
tccggtactactggattacaaaaaactacaataaaattttcattaaaaaaaaacgataaa
aattaa

DBGET integrated database retrieval system