KEGG   Buchnera aphidicola (Cinara tujafilina): BCTU_180Help
Entry
BCTU_180          CDS       T01528                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
baj  Buchnera aphidicola (Cinara tujafilina)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:baj01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:baj00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:baj00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(216744..217349)
Genome map
AA seq 201 aa AA seqDB search
MKSRYKILLKKLKLNKEGCFIPFIILGDPSIDVSLKIIDVLIQSGVDALELGIPFSDPIA
DGIIIQKAHLRSFFSKMTVKKCFLMLHIIRKKYPFIPIGLLVYMNIIFSYGISKFYAKCS
SIQIDSILIADMPYEESSDIRRTSKKYNIAQVFICPPDAETKIIKKISKYSQGYIYLLSR
SGTTGLQKTTIKFSLKKNDKN
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcacgatataaaattttattaaaaaaattaaaattaaataaagaagggtgtttt
attccatttataatattaggtgacccatctatagatgtatccttaaagattattgatgta
cttattcaaagtggtgttgatgctttagaattaggcattcctttttctgatcctattgca
gatggaattattatacaaaaagcacatttacgttctttttttagtaaaatgacagtaaaa
aaatgttttttaatgttacatattattagaaaaaaatatccgtttattccaattggactt
ttagtatacatgaatattattttttcttatggaatctcaaaattttatgctaaatgttct
tctatacaaatagattctatattaatagcagatatgccttatgaagaatctagtgatatt
cgacgtacctctaagaaatataatatcgctcaagtatttatttgccctcctgatgctgaa
acaaaaataattaaaaaaatatcaaaatatagtcaaggatatatatatctattatcaaga
tccggtactactggattacaaaaaactacaataaaattttcattaaaaaaaaacgataaa
aattaa

DBGET integrated database retrieval system