KEGG   Buchnera aphidicola (Cinara tujafilina): BCTU_181Help
Entry
BCTU_181          CDS       T01528                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
baj  Buchnera aphidicola (Cinara tujafilina)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:baj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCTU_181 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCTU_181 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCTU_181 (trpB)
Enzymes [BR:baj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BCTU_181 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(217333..218535)
Genome map
AA seq 400 aa AA seqDB search
MTLLNPYFGKFGGMYVPQILMPALYQLENAFINSLHDKIFQDKLSNLLKNYAGRPTPLTL
CNNLTQGTNTKIYLKREDLLHGGAHKTNQVLGQILLAQYMNKNNIIVETGAGQHGIASAS
ASALFNLNCRIYMGEKDIKRQSANVAKMKIMGATVIPVSIGTKTLKEACNAALRDWTENY
SNAYYMLGTAAGPHPYPTIVREYQKIIGKETKQQILLKEKKLPDKIIACIGGGSNSIGIF
NNFIKNKEVKLIGVEPAGLGLKTKKHGSAIQKGKIGIYFGMKSYLMQDNDGQISDSWSIS
AGLDFPAVGPEHAWLHDIKRVKYVSITDTEAVQAFLLLSKKEGIIPALESSHALAYALKL
MNNSPSKKQTIIVNLSGRGDKDMSTIKKMINTENNNEITI
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacattactaaacccttattttggaaaatttggtggaatgtatgtacctcaaatctta
atgccggcattatatcaattagaaaatgcgtttattaattctttacatgataaaattttt
caagataaattatctaatttattaaaaaattatgctggacgacctacacccttgacttta
tgtaataatttaacacaaggtactaatacaaaaatttatttaaaacgagaagatttatta
catggaggggctcataaaaccaatcaagtactaggacaaatattactagcacaatatatg
aataaaaataatatcattgtagaaacaggagcaggacaacatggaatagcatctgcgtct
gcatcagcattatttaacttaaattgtcgtatttatatgggtgaaaaagatattaaaaga
cagtcagctaatgttgcaaaaatgaaaattatgggagcaacagtaattcctgtatcaata
ggtactaaaacactaaaagaagcatgtaatgcagcattacgagattggacagaaaattat
tctaacgcatattatatgttaggtacagcagcaggacctcatccatatcccacaattgta
cgagaatatcaaaaaattattggaaaagaaacaaaacaacaaattttacttaaagaaaaa
aaactaccagataaaataattgcttgtattggaggaggttctaattctataggaatattt
aataattttataaaaaataaagaagttaaattaattggagtagaacctgccgggttaggt
ttaaaaacaaaaaaacatggttctgctatacaaaaaggaaaaataggaatttattttggt
atgaaatcttatttaatgcaagataatgacgggcaaataagtgattcttggtcaatttct
gccggtttagattttcctgctgtcggtccagagcatgcttggttacatgacattaaaaga
gtaaaatatgtatcaattacagatacagaagcagttcaggcttttttattattatctaaa
aaagaggggataatcccggctttagaatcttcacatgcattagcttatgcattaaaatta
atgaataattctccttctaaaaaacaaacaattatagtaaatttatctggtcggggggat
aaagatatgtctactattaagaaaatgataaatactgagaataacaatgaaatcacgata
taa

DBGET integrated database retrieval system