KEGG   Buchnera aphidicola (Cinara tujafilina): BCTU_182Help
Entry
BCTU_182          CDS       T01528                                 

Gene name
trpc
Definition
indole-3-glycerol phosphate synthase/N-(5'-phospho-ribosyl)anthranilate isomerase
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
baj  Buchnera aphidicola (Cinara tujafilina)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:baj01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:baj00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(218559..219935)
Genome map
AA seq 458 aa AA seqDB search
MNSNTLNNILHYKNEWIKLHKLKKPLESFYSNIKNQKFLKRNTKNNPAFILECKKASPSI
GLLRTKFNIPKIIQVYKKYASAISIVTENKFFKGKFKYLKQASQCTNKPLLCKDFFIDPY
QIYYARYYQADAILLMMSILSNSQYVIMSNVAKKMNIDIVTEVHNISELHRALSLNADII
GINNRNLKNLSIDLKTTCRIAPLVPSDRIVISESGINKYKQIRMLSRYVNGFLIGSHLMK
SNSLKKTVCSMIYGKNKVCGLTRVEDAFIVKKSGSIYGGLFFYKSPRYIKLRDCKKITSQ
VKLKYVGVFYNSCMKYILSRVIKLSLAVVQLHGQENQDYIKKLRSLLPKNVKIWKALPVF
NNFPIERYNYINCYLIDHKNGGTGKNLIGILLKKNNVSKMMLAGGLKLNNIFQASTLGFC
GLDLNSGLEISPGIKDSKKIRHAFNIIKNFPAQYILKN
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtaatacattaaataatatattacactataaaaatgaatggataaaactacat
aaattaaaaaagccattagaatcattttatagcaatataaaaaatcaaaaatttttaaaa
agaaatacaaaaaataacccagcatttattttagaatgtaaaaaagcttctccttctata
ggactattaagaactaagtttaatattccaaaaatcatccaagtttataaaaaatatgcc
agtgcaatatctattgtgacagaaaataaattttttaaaggtaaatttaagtatttaaaa
caagcatctcaatgcactaataaacctctcttatgtaaagatttttttatagatccatat
caaatttattacgctagatattatcaagccgatgctattttattaatgatgtctatttta
agtaattctcaatatgttattatgtctaatgtagcaaaaaaaatgaatatcgatattgtt
acagaagtacataacatatcagaattacatcgtgcattatcacttaatgcagatataatt
ggaattaataatagaaatttaaaaaatttatctatagatttaaagacaacatgtcgtatc
gcacctctagttccttcagatcgaattgttatttctgaatccggaattaataaatataaa
caaattcgtatgttaagtcgttacgttaatggatttttaataggtagtcatttaatgaaa
tccaattctcttaaaaagactgtatgtagcatgatatatggaaagaacaaggtatgcgga
ttaacaagagtagaagacgcatttattgtaaaaaaaagcggtagcatctatggaggttta
tttttttataaatctcctcgatatatcaaactacgcgattgcaaaaaaataactagtcaa
gttaaattaaaatatgttggagttttttataattcttgtatgaaatatattttatccaga
gtaataaaattatctttagcagtagtccaattacatggacaagaaaatcaagattatatt
aaaaaattacgcagtttactaccaaaaaatgtaaagatctggaaagcgttaccagttttt
aataattttcctatagaaagatataactatataaattgttatttaatagaccataaaaat
ggaggtaccggaaaaaatttgattggaatattattaaaaaaaaataatgtttccaagatg
atgttagcaggaggtttaaaattaaataatatatttcaagcatcgactttaggtttttgt
ggcttagatttaaattcaggattagaaatttctccgggaattaaagattctaaaaaaatt
agacacgcgtttaatattataaaaaattttccagcacaatatatattaaaaaactaa

DBGET integrated database retrieval system