KEGG   Buchnera aphidicola (Cinara tujafilina): BCTU_195Help
Entry
BCTU_195          CDS       T01528                                 

Gene name
sucB
Definition
(RefSeq) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
baj  Buchnera aphidicola (Cinara tujafilina)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:baj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCTU_195 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCTU_195 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BCTU_195 (sucB)
Enzymes [BR:baj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BCTU_195 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
237206..238393
Genome map
AA seq 395 aa AA seqDB search
MTDTKVLVPELPESISNAIVLKWHKNIGDVVKEDDLIAEIETDKIILEISSPTSGVIKSQ
FYKIGESVKSKDILASISHKISLKKEKVHKINGIINNNRKNNKNEIKNNNNENLKSFTPA
IRRMLLNKTIDIKNIKINKINNQFISDNIIKNNNKIEKNKKDHRSITRIKINTLQKKISE
KLLYTMQNTAMLTTFNEINMQEVIRIRTKHKEAFFKKYDVHLGFMSFFIRAATQALMMFP
DINASIDNNEVIYHDYYDINVAIATKRGLIAPILLNTNLMDMFEIEKKIKYYADLGTTGK
LSLNDLNSGTFTITNGGVFGSLMSTPIINPPQVAILGIHNIKNRPIVDDNIIKSCPMMYI
ALSYDHRLIDGKTAIKFLKYIKDILEDSSRMILKI
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgacagatactaaagttttagttccagaattacctgagtctattagtaatgcgattgtt
ttaaaatggcacaaaaatattggagatgttgtaaaagaagatgatttaattgcagaaatt
gaaaccgataaaatcattttagaaatttcttcaccaacttctggcgtaataaaatcacag
ttttataaaataggagagtctgtaaaatcaaaagatattttagcttctatttctcataaa
atttctttaaaaaaagaaaaagtacataaaattaatggaattattaataataatagaaaa
aataataaaaatgaaataaaaaataacaataatgaaaatttaaaaagttttactccggca
atacgtagaatgttattaaataaaactatagatattaaaaacataaaaattaataaaata
aacaatcaatttatttctgataatattattaagaataataataaaattgaaaagaataaa
aaggatcatcgttcaattactcgtattaaaataaatacattacaaaaaaaaatatctgaa
aagttgttatatacaatgcaaaataccgcaatgttaacaacatttaatgaaataaatatg
caagaagttatacgaatacgaacaaaacataaggaagcattttttaaaaagtatgatgta
catttaggttttatgtctttttttataagagccgcaactcaagctttaatgatgtttccg
gatattaatgcttcgattgataataatgaagttatttatcatgattattatgatattaat
gtcgctatagcaacaaaacgtggattaatagctcctatactacttaataccaatttaatg
gatatgtttgaaatagaaaaaaaaataaaatattatgcagatttaggaacaacaggaaaa
ctatctttaaatgatttaaattcaggaacttttacaatcactaatggtggtgtttttgga
tcattaatgtctacaccgataataaatccacctcaagtagcaattttaggaatacataat
attaaaaatagacctattgtagatgataatataatcaaatcatgtccgatgatgtatata
gcattatcatatgatcatcgattaattgatggaaaaacagcgataaagtttttaaaatat
ataaaagatattttagaagattcatctcgaatgatattaaaaatataa

DBGET integrated database retrieval system