KEGG   Buchnera aphidicola (Cinara tujafilina): BCTU_196Help
Entry
BCTU_196          CDS       T01528                                 

Gene name
gpmA
Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
baj  Buchnera aphidicola (Cinara tujafilina)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:baj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCTU_196 (gpmA)
   01230 Biosynthesis of amino acids
    BCTU_196 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCTU_196 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BCTU_196 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCTU_196 (gpmA)
Enzymes [BR:baj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCTU_196 (gpmA)
Exosome [BR:baj04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCTU_196 (gpmA)
  Exosomal proteins of melanoma cells
   BCTU_196 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
238694..239389
Genome map
AA seq 231 aa AA seqDB search
MNKIKVIFMRHGESEWNQSNQFTGWQDVLLSKKGIQEAQIAGKLLKKNGFFFDYAYTSML
SRAIYTLWYILKILKETWIPIKKSWQLNERHYGALEGLNKKKIRSIYSKEQIQLWRRSFL
HTPPALDIKDTRYPGYDRRYITLNKNELPVSESLENTYNRVIPYWKNVILPTIKDKKKII
VVAHGNSLRALIKYLNNINNDNIINLNISTGAPIVYEFSDTLCPLNYYYLK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaataaaagtaatttttatgagacacggggaaagcgaatggaatcagtctaat
caatttactggatggcaagatgtattattatctaaaaaaggaatacaggaagcacagatt
gcaggaaaacttttaaagaaaaatggatttttttttgattatgcttatacatctatgcta
agtcgagcaatttatacattatggtatattttaaaaatattaaaagaaacttggattcct
attaaaaaatcatggcaattaaacgaacgtcattacggcgctttagaaggattaaataaa
aaaaaaattagaagtatatatagtaaagaacaaatacaattgtggagaagaagttttctt
cataccccccctgctttagatattaaagatacacgataccctggttatgatcgacggtat
attacattaaataaaaacgaacttccagtatcagaaagtttagaaaatacctataatcgc
gttattccatattggaagaatgttattcttcctaccattaaagataaaaaaaaaataatt
gttgtagctcacggaaattctttacgagctttaattaaatatttaaataatattaataac
gataatattattaatcttaatatttctacaggtgctccaattgtatatgaattttcagat
actttatgtccattaaattattattatttaaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system