KEGG   Buchnera aphidicola (Cinara tujafilina): BCTU_197Help
Entry
BCTU_197          CDS       T01528                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
baj  Buchnera aphidicola (Cinara tujafilina)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:baj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCTU_197 (pfkA)
   01230 Biosynthesis of amino acids
    BCTU_197 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCTU_197 (pfkA)
   00030 Pentose phosphate pathway
    BCTU_197 (pfkA)
   00051 Fructose and mannose metabolism
    BCTU_197 (pfkA)
   00052 Galactose metabolism
    BCTU_197 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BCTU_197 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BCTU_197 (pfkA)
Enzymes [BR:baj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BCTU_197 (pfkA)
Protein phosphatases and associated proteins [BR:baj01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BCTU_197 (pfkA)
Messenger RNA biogenesis [BR:baj03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BCTU_197 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
239588..240550
Genome map
AA seq 320 aa AA seqDB search
MIKIIGILTSGGDAPGMNAAIRAVTHTALNKGLNVIGIQDGFLGLFKNRMIQLQKSNVSN
IINRGGTLLGSARFPEFSQKDIRLTSIKNLYQRKIDALIIIGGDGSYIGAKYLTNMGLPC
IGIPGTIDNDVAGTDYSIGYFTALETIVEAIDRLQDTSASHKRISIVEIMGRYCGDLTLA
ASIAGGCEFIILPEITYTKENLLIDIKKSIKNGKNHAVIAITEHLYDVKKLARYIQEKTK
RETRATTLGYIQRGGTPVVYDRILASRMGSYAVKLLLEGYQGRCVGIINEVLVHHDINNA
LKYMKKPFKSDWLVTAKNLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaataattggcatattaactagtggcggcgatgcacccggaatgaatgctgca
attcgagcagtaacacataccgctttgaataaagggttaaatgtcataggaattcaagat
ggatttttaggtttatttaaaaatcgtatgatacaattacaaaagtctaatgtttcaaat
attattaatcgaggcggaacacttttaggatctgctcgttttcctgagttttctcaaaaa
gatattcgattaacttctataaaaaatctttatcagagaaaaattgatgctttaattatt
attggtggagacgggtcatatatcggggcaaaatatttaactaatatgggtttaccgtgt
atcgggattcctggaactattgataatgatgtagcaggaactgattattcaatcggatat
tttactgctttagaaacaatagttgaggctattgatagattacaagatacttctgcttct
cataaacgtatatcaattgtagaaataatggggcgttattgcggtgatcttaccctagct
gcgtcaatagctggaggttgtgagtttattatattacctgaaattacctatacaaaagaa
aatttattaatagatattaaaaaaagcataaaaaatggaaaaaatcatgcagttattgca
attaccgagcatttatatgatgttaaaaaactagcacgatatattcaagaaaaaactaaa
agagaaactagagctacaactctgggatatattcaaagaggaggaactcctgttgtttat
gatagaattttggcttctcgtatgggatcttatgctgttaaattgcttttagaaggatat
caaggtagatgtgttggaattattaatgaagttttagtgcatcatgatataaataatgct
cttaaatatatgaaaaaaccttttaaaagtgattggttagtaactgcaaaaaatttatac
taa

DBGET integrated database retrieval system