KEGG   Buchnera aphidicola (Cinara tujafilina): BCTU_198Help
Entry
BCTU_198          CDS       T01528                                 

Gene name
tpiA
Definition
triose phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
baj  Buchnera aphidicola (Cinara tujafilina)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:baj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCTU_198 (tpiA)
   01230 Biosynthesis of amino acids
    BCTU_198 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCTU_198 (tpiA)
   00051 Fructose and mannose metabolism
    BCTU_198 (tpiA)
   00562 Inositol phosphate metabolism
    BCTU_198 (tpiA)
Enzymes [BR:baj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BCTU_198 (tpiA)
Exosome [BR:baj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BCTU_198 (tpiA)
  Exosomal proteins of bladder cancer cells
   BCTU_198 (tpiA)
  Exosomal proteins of melanoma cells
   BCTU_198 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(240730..241494)
Genome map
AA seq 254 aa AA seqDB search
MIKPIIIGNWKLNGSKKFILRILKPLNQFLIKYYKICTVVLAPPLLYANFIQNILSTDQK
KFFLGSQNVDVHFSGPFTGEISPIMLKDMGIQYVIIGHSERRLNHYENNALVAKKFYMLK
EENLIPILCIGETIQEHNDKKTKEICKKQIDLIFDLCGKNAFNNSIIAYEPIWAIGSGQS
ASPKEVQNISCFIRNYIKSKSNNNIKNFFIQYGGSVSQHNVQELIYQHDIDGFLIGGASL
ILKEFKKIIKIINK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaccaattattatcggtaactggaaattgaatggtagtaaaaaatttatttta
cgcattttaaaaccattaaatcagtttctcataaaatattataaaatttgtacagttgta
ttagctcctcctttattatatgctaattttattcaaaatattctatctactgatcaaaaa
aaattttttttaggttctcaaaatgttgatgtacatttttcaggaccgtttaccggagag
atttctccaatcatgttaaaagatatgggaattcaatatgttattattggacattccgaa
agacgtttaaatcattatgaaaataatgcattagttgctaaaaaattttatatgttaaaa
gaagaaaatttaataccaatattatgtataggagaaacaattcaagaacataatgataaa
aaaactaaagaaatatgcaaaaaacaaatagatttaatatttgatttatgtggaaaaaat
gcatttaataattctattattgcatatgaaccaatttgggcaatagggtcaggacaatct
gcatcaccaaaagaagtacaaaatatatcttgttttatacgaaattatattaaaagtaaa
tctaataataatattaaaaatttttttattcaatacggtggttctgtttctcagcataat
gttcaagaattaatttatcaacatgatattgatggttttttaattggaggagcatctctc
attttaaaagaatttaaaaaaattataaaaataataaataaataa

DBGET integrated database retrieval system