KEGG   Buchnera aphidicola JF99: CWS_00465Help
Entry
CWS_00465         CDS       T02354                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bajc  Buchnera aphidicola JF99
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bajc01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bajc00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
98964..100091
Genome map
AA seq 375 aa AA seqDB search
MTCSITELAKKLISIPSVSPKDLGCQDIIIKRLCAIGFDIKRVNVNDTKNFWAFRGIGKT
LTFAGHTDVVPIGQDKDWQTDPFQPVIRSGYLFGRGSADMKGALAAMITAAERFVNKFPN
HKGRLSFLITSDEESSAVDGTIKVVEYLMSKRDMIDYCIVGEPSSTNVVGDVIKNGRRGS
ITANITIHGIQGHIAYPDLADNPIHKGLPVILKILSIKLDSGNDFFLPSSINIANIHAGN
GFNNVIPGSLFVQFNIRFSSEVSEKHIQSQIVNILNSNDINYSIEWLFSGKPFITKKGLL
IDTVIQSIFYFNKKKPILSTSGGTSDGRFIALMGSEVVELGLVNNTIHKVNECVKISDLK
LLSCMYEDIMKNLLS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgacttgttctattactgaattagcaaaaaaactaatttctattccttctgttagtcca
aaagatttaggttgtcaagatattataataaaacgtttatgtgcaataggatttgacatt
aaaagagtaaatgttaatgatacaaaaaatttttgggcttttagaggtataggtaaaaca
ttaacatttgcaggacatacagatgtagttccaataggtcaagataaagattggcaaact
gatccttttcaaccagtcatacgaagtggatatttatttggcagaggttctgctgatatg
aagggtgctttagcagcaatgattactgcggctgaaagatttgtaaataagtttccaaat
cataaaggacgtttgtcttttcttattacttcagacgaagagtctagtgcagttgatgga
acaattaaagtagtagaatatttaatgtctaaaagggatatgattgattattgtatagta
ggagaaccctctagtactaatgtagtgggtgatgttataaaaaatggtcgacgtggttca
attacagctaatataactattcatggaatacaggggcatattgcatatcctgatttagca
gataatccaatacataaagggttacctgttattttaaaaatattgtctataaaattagat
tctggaaatgacttttttttacctagcagcataaatattgcaaatattcatgcaggaaat
ggatttaataatgtgattccaggatctctatttgttcaatttaatattagatttagttcc
gaagtttctgaaaaacacattcaatctcaaatagtaaatatattaaattcaaatgatatt
aattattctatagaatggttattttcaggaaaaccatttatcactaaaaaaggtttattg
atagacacagtgatacaatctattttttattttaacaaaaaaaagcctattttatctact
tctggtggcacttctgacggtcgatttattgctttaatgggttctgaagtagtagagtta
ggattagtcaataatacaattcataaagttaatgaatgtgtcaaaatatctgatttaaaa
ttattaagctgtatgtatgaagatattatgaaaaatttattatcctaa

DBGET integrated database retrieval system