KEGG   Buchnera aphidicola JF99: CWS_00500Help
Entry
CWS_00500         CDS       T02354                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bajc  Buchnera aphidicola JF99
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bajc01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:bajc00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
105094..106401
Genome map
AA seq 435 aa AA seqDB search
MKYFKNIIFWNKLHLDEQKKILSRPILKENNFIKKTVKEIIENVRLFGNSALKKYTFLFD
KQDINTFQVSKEKISSSSFYLSKVLKDSISVAQKNITCFHKAQIPSKIDVETEVGVRCEQ
IYLPLNSIGIYIPGGTAPLFSTVLMLAIPAKISGCKKIILCSPPPISNEVLYAAHICGIH
DIYQVGGAQAIAALALGTETVPKVDKIFGPGNAYVTEAKLQVSSIFNGTEIDMLAGPSEL
LIIADNTANPDFIAADLLSQAEHGVSSQVILLTPCFELAEKVVLSINKQLNNLSRLSEIL
KTLKNSSVIIVKNLSECIEISNMYAPEHLIIQTQSPREVLNYISNASSIFLGLWSPESAG
DYASGTNHVLPTYGKSITNSSLGLCDFQKRVLVQELTAKGLMKLSNTIEILSSAEKLQAH
KNAVKIRVDFLKGKI
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattttaaaaatataattttttggaacaaactacatcttgatgaacaaaaaaaa
atattatcaagacctattttaaaagaaaataacttcattaaaaagactgtaaaagaaatt
atagaaaatgttagattatttggaaattcagcattaaaaaaatatacttttttatttgat
aaacaagatataaatacatttcaagtttcaaaagaaaaaatctcttcatcttcgttttat
ttaagtaaggttctaaaagattccatttctgtcgcgcaaaaaaatattacatgttttcat
aaagctcaaattccatctaaaatagatgttgaaacagaagttggagtccgttgtgagcaa
atctatttacctctaaattctataggaatttatattcctggcggaacagctcctttattt
tcgactgtattaatgttagcgatacctgctaaaatttctggttgtaaaaaaattattctt
tgctctcctcctccgattagtaacgaggttctttatgctgctcatatttgtggaattcat
gatatttatcaagttgggggagctcaggctatagctgcactcgctttaggtactgaaacg
gtccctaaagtagataagatttttggaccaggcaatgcgtatgttacagaagcaaaatta
caagttagttcaatctttaatggaacagaaatagacatgttagcaggaccttcagaatta
ttaatcattgctgacaacactgctaatccagattttattgccgctgatttattatcacaa
gctgaacatggtgtttcttctcaagtaattttgcttacaccatgttttgaattagcagaa
aaggtagtgctttccattaataaacaactgaataatttatctagattatcagaaattttg
aaaacattaaaaaacagtagtgtcataattgtcaaaaatttatcagaatgtattgaaatc
tctaatatgtatgcacctgaacatctaattattcaaacacaatcacctagagaagtactt
aactacatctctaatgctagttctatttttcttggtttatggtctcctgaatctgccgga
gattatgcgtctgggacaaatcatgttttaccaacatatggaaaatctattacaaattcg
tctttaggattgtgtgattttcaaaaacgtgtattagttcaagaattaacagctaaagga
ctaatgaaattatctaatactattgaaattttatcttccgcagaaaaacttcaagcacat
aaaaatgctgtaaaaattcgcgtagattttttaaagggaaaaatatga

DBGET integrated database retrieval system