KEGG   Buchnera aphidicola JF99 (Acyrthosiphon pisum): CWS_00890Help
Entry
CWS_00890         CDS       T02354                                 

Gene name
ipk
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bajc  Buchnera aphidicola JF99 (Acyrthosiphon pisum)
Pathway
bajc00900  Terpenoid backbone biosynthesis
bajc01100  Metabolic pathways
bajc01110  Biosynthesis of secondary metabolites
bajc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bajc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CWS_00890 (ipk)
Enzymes [BR:bajc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CWS_00890 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADP67147
Position
complement(183474..184358)
Genome map
AA seq 294 aa AA seqDB search
MNKRNQKKMIYTCLSPAKINLFLYVTGRRKDGYHNIQTLFQFLDYGDQFKIIANKTGNIE
LFTEKKIFMNVQNSIIIAAKLLKKTALLQGKLQNSSYGAKIFLKKNIPMGSGLGGGSSNA
ATTLVVLNKLWNTQYTLKELSLLGLRIGADVPGFVMGNTAVIEGIGDILYPIVQKEKWYL
VVYPCINISTRYMFSSPFLMSNTAKKSLQVLLKTPFKNDFENIAKKQFVPIKKLIRMLSS
YAPSRMTGTGSCVFSEFDNKKSAQKIFSVLPKNVQGFIAKSVNISPLHKTLYKR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacgaaaccaaaaaaaaatgatttatacatgtttgtctcccgcaaaaattaat
ctttttctatatgtcacaggtagacgaaaagatggatatcataatatacaaacattgttt
caatttcttgattatggtgatcaattcaaaataattgctaataaaacaggtaatattgaa
ttattcactgaaaaaaaaatttttatgaatgtacaaaatagtattattattgctgctaaa
ctattaaaaaaaactgcactcttacaaggtaaattacaaaattctagttatggagcaaaa
atatttttaaaaaaaaacatacctatgggtagtggattaggaggaggttcttcaaacgct
gcaaccactttagttgttctaaacaaattatggaatacacaatatacattgaaagaacta
tctttattaggactcagaataggggctgacgtacctggttttgttatgggcaatacagct
gttattgaaggaataggagatatattatatcctattgtgcaaaaagaaaaatggtattta
gttgtctatccttgtattaatatttcaacacgttatatgttttcaagtccatttttaatg
agtaatacagctaaaaaatcactccaagtattattaaaaacaccttttaaaaatgacttc
gaaaatatagcaaaaaaacaatttgtcccaataaaaaaattaattagaatgttatcttca
tatgcgccttcacgcatgactggcacaggatcttgtgttttttctgaatttgataataaa
aaatctgcacaaaaaattttttccgtgttacctaaaaacgtccaagggtttatagcaaaa
agtgttaatatttcaccattgcataaaactctttataaacgataa

DBGET integrated database retrieval system