KEGG   Buchnera aphidicola JF99 (Acyrthosiphon pisum): CWS_01080Help
Entry
CWS_01080         CDS       T02354                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bajc  Buchnera aphidicola JF99 (Acyrthosiphon pisum)
Pathway
bajc00010  Glycolysis / Gluconeogenesis
bajc00020  Citrate cycle (TCA cycle)
bajc00620  Pyruvate metabolism
bajc01100  Metabolic pathways
bajc01110  Biosynthesis of secondary metabolites
bajc01120  Microbial metabolism in diverse environments
bajc01130  Biosynthesis of antibiotics
bajc01200  Carbon metabolism
Module
bajc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bajc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CWS_01080
   00020 Citrate cycle (TCA cycle)
    CWS_01080
   00620 Pyruvate metabolism
    CWS_01080
Enzymes [BR:bajc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CWS_01080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ADP67181
Position
226517..227725
Genome map
AA seq 402 aa AA seqDB search
MDIEVKMPDIGLEEVEIIEILVSINEKIAPEQGLITVEGDKTSMEIPSPISGIVKHIFIK
IGEKIKTDALIMRCEVENIDFHVKKKEEICLDNNVLNKVEKNFKKDIFFHATPLIRRLAR
NLNINLYDVVGTGPKNRILKEDLDLYQSNIKENLIEEKNKINFGDSKKSKTKELELSDIQ
KNIGNNLHRNWMNIPHVTQFDEVDITILEKFRQKYNNEKRNQKKTNENITILVFIIKVVA
YALEKFPIFNSSLNINNKKIILKKYINIGFAIDVNNDLFVPVLKDVNKKNIKQLSSELIL
LSEKARTRKLNIEDMTGGCFTISNLGGIGGSWFSPIINSPEVAILGISKSQIKPSWNGKE
FIPSLMLPLSLSYDHRVINGAYAARFITFISRVLSDMHFLIM
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtggatatagaagtcaaaatgcctgatattggtttagaagaagtagaaataattgaaata
ttagtaagtattaatgaaaaaatagcaccagaacaaggattaataactgtggaaggagat
aaaacttctatggaaataccttcacctatatcaggtattgtaaagcatatcttcattaaa
attggcgaaaaaattaaaactgatgctcttatcatgagatgtgaagtggagaatattgat
tttcatgtaaagaaaaaagaagaaatttgtttagataataatgttttaaataaggttgaa
aaaaatttcaaaaaagatattttttttcatgcaactccattaataagacgtttagctcga
aatttaaatataaatttatacgatgttgttggtaccggacctaaaaataggattttaaaa
gaagatttagatctatatcaaagtaatattaaagagaatcttatagaagaaaaaaataaa
attaattttggtgattctaagaaatcaaaaacaaaagaattagaattaagtgatatccag
aaaaatattggtaataatttacatcggaattggatgaatatacctcatgttacacaattt
gatgaagttgatattactatattagaaaagtttcgtcaaaaatataataacgaaaagaga
aatcaaaaaaaaacaaatgaaaatattacaattttagtttttataataaaagtagttgca
tatgcattagaaaaattccctatttttaacagttcactaaatattaataataaaaaaatt
attttaaaaaaatatattaatatcggttttgcaatagatgtaaataacgatttatttgtt
cctgttttaaaagacgtcaataaaaaaaatattaaacaattatcttctgaattaatattg
ctatcagaaaaagcacgaacaagaaaattaaatattgaagatatgacaggaggctgtttt
acaatatctaatttaggaggtattggaggaagctggttttcaccaattatcaattcaccg
gaagtagcaattcttggtatttcaaaatctcagataaaaccgtcatggaatggaaaagaa
tttattccttctttaatgttaccattatctttatcttatgatcatcgtgtaataaatggt
gcttatgcagcgcgttttattacatttattagtagagttttatcagatatgcatttttta
attatgtag

DBGET integrated database retrieval system