KEGG   Buchnera aphidicola JF99: CWS_01450Help
Entry
CWS_01450         CDS       T02354                                 

Definition
bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase (EC:4.1.1.48)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
bajc  Buchnera aphidicola JF99
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bajc01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:bajc00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(305113..306474)
Genome map
AA seq 453 aa AA seqDB search
MQDTTLKKIIQDKSEWIRLRKEKQPLIDFKDKINKKTRDFYHSLKEKKPCFILEYKKKSP
SLGIIRNNFNLIEISNVYKKYASSVSVLTDEKYFHGNLNFINIVRECVSQPVLCKDFFID
PYQVYLSRYYNADAILLMLSVLNDIQYKELSIIAKKLNMGILTEVNNIEELKRALKLNAN
IIGINNRNLHDLSIDLNRTRTLSSLIKKDTIIISESGIKKYREIKELSKFVNGFLIGSHL
MSQTNLETAVRSIIFGDNKVCGLTRSIDIEVSEKYGAIYGGLIFVKNSPRYITKKTAKNI
SINRKLKLIGIFQNENINIIVDIAEELSLYGVQLHGQENKQYIDKLRNILPKKINIWKAF
SIQSELPDRNWDNVNMYIFDSDSGGSNTSFNWSILNHHILDNVILAGGINLKNCITASKL
KCSGLDLNSGVEISPGIKDCKKIKSIFQKLRYG
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacacaacacttaaaaaaattatacaagataaaagtgaatggattagattaaga
aaagaaaaacagcctttaattgattttaaagataaaataaataaaaaaacacgggatttt
taccattctttaaaagaaaaaaaaccatgttttatattagaatataaaaagaaatctcct
tctttaggtatcattagaaacaattttaatttaattgaaatttctaatgtttacaaaaaa
tatgcatcttctgtttcagtcctaacagatgaaaaatattttcatggaaatttaaatttt
ataaatatagtaagagaatgtgtttctcaacctgttttatgcaaagatttttttattgat
ccatatcaagtatatttatctagatattataatgcagatgctattttattaatgttatct
gttttaaatgatatacagtataaagaactatctataattgcaaaaaaattaaatatgggc
atactaactgaagtaaataatatagaggaattaaaacgtgctctaaaattaaatgctaat
attataggtattaacaatcgcaatttgcatgatttatcaattgatttaaatcgtacacgt
actttatcttctttaattaaaaaagatactataataataagcgaatcaggtataaaaaaa
tatagagaaataaaagaacttagtaaatttgtcaatggttttttaattggttctcatttg
atgtctcaaactaatttagagacagccgttcgttctataatttttggtgataataaagtc
tgcggattaactcgtagtatagatatagaagtttctgaaaaatacggagcaatttacggt
ggacttatttttgtaaaaaattctcctcgttatattactaaaaaaactgcaaaaaatatt
tctataaatagaaaattaaaattgatcggaatttttcaaaatgaaaatatcaatattatc
gtagatattgctgaagaactatcactttatggtgtacaactgcatggacaagaaaataaa
caatatattgataaattaaggaacatactacctaaaaaaatcaatatttggaaagctttt
tctattcaatcagaattgccagatcgcaattgggacaatgtaaatatgtatatatttgac
tctgattctggaggaagtaatacatcttttaattggtctattttaaaccatcatatttta
gataatgttattttagctggaggaattaatttgaagaattgtattacagcttctaaacta
aaatgctcaggattagatttaaattccggcgtagaaatatctcctggcattaaagactgc
aagaaaataaaatcaatttttcaaaaattaagatatggttaa

DBGET integrated database retrieval system