KEGG   Buchnera aphidicola JF99 (Acyrthosiphon pisum): CWS_01450Help
Entry
CWS_01450         CDS       T02354                                 

Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
bajc  Buchnera aphidicola JF99 (Acyrthosiphon pisum)
Pathway
bajc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bajc01100  Metabolic pathways
bajc01110  Biosynthesis of secondary metabolites
bajc01130  Biosynthesis of antibiotics
bajc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bajc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CWS_01450
Enzymes [BR:bajc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CWS_01450
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     CWS_01450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI CBM26 QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADP67253
Position
complement(305113..306474)
Genome map
AA seq 453 aa AA seqDB search
MQDTTLKKIIQDKSEWIRLRKEKQPLIDFKDKINKKTRDFYHSLKEKKPCFILEYKKKSP
SLGIIRNNFNLIEISNVYKKYASSVSVLTDEKYFHGNLNFINIVRECVSQPVLCKDFFID
PYQVYLSRYYNADAILLMLSVLNDIQYKELSIIAKKLNMGILTEVNNIEELKRALKLNAN
IIGINNRNLHDLSIDLNRTRTLSSLIKKDTIIISESGIKKYREIKELSKFVNGFLIGSHL
MSQTNLETAVRSIIFGDNKVCGLTRSIDIEVSEKYGAIYGGLIFVKNSPRYITKKTAKNI
SINRKLKLIGIFQNENINIIVDIAEELSLYGVQLHGQENKQYIDKLRNILPKKINIWKAF
SIQSELPDRNWDNVNMYIFDSDSGGSNTSFNWSILNHHILDNVILAGGINLKNCITASKL
KCSGLDLNSGVEISPGIKDCKKIKSIFQKLRYG
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacacaacacttaaaaaaattatacaagataaaagtgaatggattagattaaga
aaagaaaaacagcctttaattgattttaaagataaaataaataaaaaaacacgggatttt
taccattctttaaaagaaaaaaaaccatgttttatattagaatataaaaagaaatctcct
tctttaggtatcattagaaacaattttaatttaattgaaatttctaatgtttacaaaaaa
tatgcatcttctgtttcagtcctaacagatgaaaaatattttcatggaaatttaaatttt
ataaatatagtaagagaatgtgtttctcaacctgttttatgcaaagatttttttattgat
ccatatcaagtatatttatctagatattataatgcagatgctattttattaatgttatct
gttttaaatgatatacagtataaagaactatctataattgcaaaaaaattaaatatgggc
atactaactgaagtaaataatatagaggaattaaaacgtgctctaaaattaaatgctaat
attataggtattaacaatcgcaatttgcatgatttatcaattgatttaaatcgtacacgt
actttatcttctttaattaaaaaagatactataataataagcgaatcaggtataaaaaaa
tatagagaaataaaagaacttagtaaatttgtcaatggttttttaattggttctcatttg
atgtctcaaactaatttagagacagccgttcgttctataatttttggtgataataaagtc
tgcggattaactcgtagtatagatatagaagtttctgaaaaatacggagcaatttacggt
ggacttatttttgtaaaaaattctcctcgttatattactaaaaaaactgcaaaaaatatt
tctataaatagaaaattaaaattgatcggaatttttcaaaatgaaaatatcaatattatc
gtagatattgctgaagaactatcactttatggtgtacaactgcatggacaagaaaataaa
caatatattgataaattaaggaacatactacctaaaaaaatcaatatttggaaagctttt
tctattcaatcagaattgccagatcgcaattgggacaatgtaaatatgtatatatttgac
tctgattctggaggaagtaatacatcttttaattggtctattttaaaccatcatatttta
gataatgttattttagctggaggaattaatttgaagaattgtattacagcttctaaacta
aaatgctcaggattagatttaaattccggcgtagaaatatctcctggcattaaagactgc
aagaaaataaaatcaatttttcaaaaattaagatatggttaa

DBGET integrated database retrieval system