KEGG   Buchnera aphidicola JF99 (Acyrthosiphon pisum): CWS_03055Help
Entry
CWS_03055         CDS       T02354                                 

Definition
uroporphyrinogen-III synthase, putative
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bajc  Buchnera aphidicola JF99 (Acyrthosiphon pisum)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bajc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CWS_03055
Enzymes [BR:bajc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CWS_03055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
626354..626767
Genome map
AA seq 137 aa AA seqDB search
MKIINKDKIKNNRIILLQGENGRKLIKRRLEKEGFKICLIECYKRVFKILDTNMEVKKWR
SYKIDTLVVTNSESLHQLKNIISSTNQIQWLFGCRIFVVGKRLFRIAKKLGWNDVIVSKY
ANNDSFIKKIKETNFKN
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaataatcaataaagacaaaataaaaaataatagaataattttattacaaggggaa
aatggacgaaaattaataaaaagaagattagaaaaagaaggatttaaaatttgtctaatt
gaatgttataaaagagtcttcaaaattttagatactaatatggaggtaaaaaaatggcgt
tcatataaaatagatactttagtagtaacaaatagcgaatctttacatcagttaaaaaat
attatttctagtactaatcagattcaatggttattcggatgcaggatttttgttgtcggt
aaaagattgtttcgtatagcaaaaaaattaggatggaatgatgtaatagtttcaaaatat
gctaataatgattcttttatcaaaaaaataaaagaaacgaattttaaaaattaa

DBGET integrated database retrieval system