KEGG   Buchnera aphidicola Ak (Acyrthosiphon kondoi): BAKON_094Help
Entry
BAKON_094         CDS       T01825                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bak  Buchnera aphidicola Ak (Acyrthosiphon kondoi)
Pathway
bak00300  Lysine biosynthesis
bak01100  Metabolic pathways
bak01120  Microbial metabolism in diverse environments
bak01230  Biosynthesis of amino acids
Module
bak_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bak00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BAKON_094 (dapE)
Enzymes [BR:bak01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BAKON_094 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Orbi_VP4
Motif
Other DBs
NCBI-ProteinID: AEO08458
UniProt: G2LMH0
Position
98985..100112
Genome map
AA seq 375 aa AA seqDB search
MICSVTKLAQKLISIPSISPKDLGCQDIIIKRLYAIGFKVKVINVNDTKNFWAFRGLGKT
LTFAGHTDVVSPGQDKYWQSDPFEPVIRNGFLFGRGSSDMKGALAAMIVASERFVKKFPN
HKGRLSFLITSDEESSAVNGTIKVVEYLISKNDVIDYCLVGEPSSTSKVGDVIKNGRRGS
ITADLTIHGVQGHIAYPDLADNPIHKGLPIILEILSIKFDNGNDFFSPTSINIANIHAGN
GTNNIIPGSLFVQFNVRFSTEVSEIEIKSRIVSILDKYNINYSITWFLSGKPFLTKKGLL
IDTVMQSIFYFNKKEPILSTSGGTSDGRFISLMGSEVVELGLINSTIHKVNECVKISDLQ
LLSYMYEDIMKKLLT
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgatttgctcagtcacaaaattagcgcaaaagctaatttctattccatctattagtcca
aaagatttaggttgtcaagatattattataaaacgtttatacgcaataggatttaaagtt
aaagtaatcaatgttaatgacaccaaaaatttctgggcttttagaggtctcggaaagaca
ttgacatttgctggacatacagatgtagtttcaccgggtcaagataaatattggcaatct
gatccttttgaaccagtaattcgaaatggatttttatttggtcgaggatcttcagatatg
aaaggtgctttagcagctatgattgttgcttctgaaaggtttgtaaagaaatttccaaat
cataaaggacgtttatcttttcttattacttcggatgaagagtcgagtgctgtgaatggt
acaattaaagtagtagaatatttaatatctaaaaatgatgtaattgactattgtttagta
ggagaaccttctagtacttctaaagttggtgatgttataaaaaatggtcgacgtggttca
attacggctgatttaactatccatggagtgcaaggacatattgcttatcctgatttagca
gataatccaatacataaaggattgcctattattttagaaatattatctataaaatttgat
aatggaaacgattttttttcacctactagcataaatattgcaaatattcatgcaggaaat
ggaactaataatattattccaggatctttatttgttcagtttaatgttcgatttagcaca
gaagtttctgagatagaaattaaatctcgaatagttagtatactagataagtataacatt
aattattctataacatggtttttatcagggaaaccatttcttactaaaaagggtttattg
atagatactgtaatgcaatctattttttattttaataaaaaagagcctattttatctact
tctggtggtacttctgatggtcgatttatttctttaatgggttcagaagtagtagaatta
ggattaattaatagtacaattcataaagttaatgagtgtgtaaaaatatctgatttacaa
ctattaagttatatgtacgaagatattatgaagaagttattaacataa

DBGET integrated database retrieval system