KEGG   Buchnera aphidicola Ak (Acyrthosiphon kondoi): BAKON_193Help
Entry
BAKON_193         CDS       T01825                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bak  Buchnera aphidicola Ak (Acyrthosiphon kondoi)
Pathway
bak00260  Glycine, serine and threonine metabolism
bak00750  Vitamin B6 metabolism
bak01100  Metabolic pathways
bak01110  Biosynthesis of secondary metabolites
bak01120  Microbial metabolism in diverse environments
bak01230  Biosynthesis of amino acids
Module
bak_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bak00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAKON_193 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BAKON_193 (thrC)
Enzymes [BR:bak01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BAKON_193 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AEO08550
UniProt: G2LMR2
Position
complement(206828..208117)
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKDHSEKVNFETAVKLGLGRQQGLFFPVELPVITPTELSKILKMDFITRSTEILS
KFIYHEISKEKLYEHVKQAFSFKAPLKIKITEDIHCFELFHGPTLAFKDFGARFMAQMIL
SLNKKNESVTILTATSGDTGAAVAHAFYGMKNVRVIILYPKGKISELQEKLFCTLGKNIK
TISINGSFDDCQKLVKEAFNDKKLKESIGLNSANSINISRLLAQICYYFEAFSLISEQER
KNLVIAVPCGNFGNLTAGLLSKSLGLPIKSFIACTNANDTVPRFLKNGTWHPKKTVSTIS
NAMDISQPNNWTRIEELFNRKKWNLKELRFGSVSDDSTEETLQELFKLGYVSEPHAAIAY
RLLRDQLKKNEFGLFLGTAHPAKFKNTVENILKNKISLPDELKNRIDLPLLSHNINPIFS
KLKKFLLEK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttataatttaaaagatcacagtgaaaaagtaaattttgaaacagctgtaaaa
ctgggattaggacggcaacaaggattattttttccagtagaattacccgttattacacct
acagaattatcaaaaatattaaaaatggattttattactcgcagtactgaaatactttct
aaatttatttatcatgagatatctaaagaaaaactatatgaacatgtcaaacaagcattt
tcatttaaggctccattaaaaataaaaatcacagaagatatacattgctttgaattattt
cacggtccaacattagcgtttaaagattttggagcgcgttttatggctcaaatgatatta
tcactaaataaaaaaaatgaatctgttactattttaactgcaacatcaggtgatacaggt
gcagcagtagcacatgcgttttatggaatgaaaaatgtacgagtaattattttatatccc
aaaggaaaaattagtgaattacaagaaaaactattttgtacattaggtaaaaatataaaa
actatatctattaacggtagttttgatgattgtcaaaaattagtaaaagaagcttttaat
gataagaaacttaaagaatcaataggattaaattctgcaaactctattaatataagcaga
ttattagcacaaatttgttattattttgaagctttttctttaatttcagaacaagaaaga
aaaaatttagttatagcggttccatgtggaaactttggcaatttaactgctggactattg
tctaagtctcttggtttaccaattaaatcatttatagcatgtactaatgctaatgataca
gtaccaagatttcttaaaaatggtacatggcatccaaaaaaaaccgtatctacaatctca
aatgccatggatattagtcaacctaataattggactcgaattgaagaattatttaatcga
aaaaaatggaatttgaaagaacttagatttggtagcgtatcggatgattctacagaagaa
acattacaagaattatttaaattaggttatgtttctgaacctcatgctgcaatagcatat
cgattattacgagatcaattaaaaaagaatgagtttggtttatttctaggtactgcacac
ccagctaaatttaaaaatactgtagaaaacatattaaaaaataaaatttcgttacctgat
gaactaaaaaatagaattgatcttccattattatctcacaatatcaatcctatttttagt
aaattaaaaaaatttttattagaaaagtaa

DBGET integrated database retrieval system