KEGG   Buchnera aphidicola Ak (Acyrthosiphon kondoi): BAKON_193Help
Entry
BAKON_193         CDS       T01825                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bak  Buchnera aphidicola Ak (Acyrthosiphon kondoi)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bak00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BAKON_193 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAKON_193 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BAKON_193 (thrC)
Enzymes [BR:bak01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BAKON_193 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(206828..208117)
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKDHSEKVNFETAVKLGLGRQQGLFFPVELPVITPTELSKILKMDFITRSTEILS
KFIYHEISKEKLYEHVKQAFSFKAPLKIKITEDIHCFELFHGPTLAFKDFGARFMAQMIL
SLNKKNESVTILTATSGDTGAAVAHAFYGMKNVRVIILYPKGKISELQEKLFCTLGKNIK
TISINGSFDDCQKLVKEAFNDKKLKESIGLNSANSINISRLLAQICYYFEAFSLISEQER
KNLVIAVPCGNFGNLTAGLLSKSLGLPIKSFIACTNANDTVPRFLKNGTWHPKKTVSTIS
NAMDISQPNNWTRIEELFNRKKWNLKELRFGSVSDDSTEETLQELFKLGYVSEPHAAIAY
RLLRDQLKKNEFGLFLGTAHPAKFKNTVENILKNKISLPDELKNRIDLPLLSHNINPIFS
KLKKFLLEK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttataatttaaaagatcacagtgaaaaagtaaattttgaaacagctgtaaaa
ctgggattaggacggcaacaaggattattttttccagtagaattacccgttattacacct
acagaattatcaaaaatattaaaaatggattttattactcgcagtactgaaatactttct
aaatttatttatcatgagatatctaaagaaaaactatatgaacatgtcaaacaagcattt
tcatttaaggctccattaaaaataaaaatcacagaagatatacattgctttgaattattt
cacggtccaacattagcgtttaaagattttggagcgcgttttatggctcaaatgatatta
tcactaaataaaaaaaatgaatctgttactattttaactgcaacatcaggtgatacaggt
gcagcagtagcacatgcgttttatggaatgaaaaatgtacgagtaattattttatatccc
aaaggaaaaattagtgaattacaagaaaaactattttgtacattaggtaaaaatataaaa
actatatctattaacggtagttttgatgattgtcaaaaattagtaaaagaagcttttaat
gataagaaacttaaagaatcaataggattaaattctgcaaactctattaatataagcaga
ttattagcacaaatttgttattattttgaagctttttctttaatttcagaacaagaaaga
aaaaatttagttatagcggttccatgtggaaactttggcaatttaactgctggactattg
tctaagtctcttggtttaccaattaaatcatttatagcatgtactaatgctaatgataca
gtaccaagatttcttaaaaatggtacatggcatccaaaaaaaaccgtatctacaatctca
aatgccatggatattagtcaacctaataattggactcgaattgaagaattatttaatcga
aaaaaatggaatttgaaagaacttagatttggtagcgtatcggatgattctacagaagaa
acattacaagaattatttaaattaggttatgtttctgaacctcatgctgcaatagcatat
cgattattacgagatcaattaaaaaagaatgagtttggtttatttctaggtactgcacac
ccagctaaatttaaaaatactgtagaaaacatattaaaaaataaaatttcgttacctgat
gaactaaaaaatagaattgatcttccattattatctcacaatatcaatcctatttttagt
aaattaaaaaaatttttattagaaaagtaa

DBGET integrated database retrieval system