KEGG   Buchnera aphidicola Ak: BAKON_222Help
Entry
BAKON_222         CDS       T01825                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bak  Buchnera aphidicola Ak
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bak00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bak00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(243561..245054)
Genome map
AA seq 497 aa AA seqDB search
MNKTCLKYLLSPWIKNIPNKYILNLKMDSRTVCKGDLFIAVRGKKKDGRNFIFEATYKKV
AAILYETEKKENHGIFKYINNIPIIYFFKLSENISMLANRFYKEPGKKLTIIGVTGTNGK
TTVIQIINQWSNILGNKIATMGTLGNGFDNSLSPTKNTTSSPLFVHSFLSQALNKQAKLV
TMEVSSHGLIENRVKEVPFYIAIFTNLTQDHLDYHENMKKYASAKWLLFSTHKVKKIILN
ADDKYGKIWLKKLFDYYTIAVTIKNSKPRKYSTKWINATDIKNYNNSIIIKFESSWGAGE
ISSCLIGYFNVTNILLALACLLELGYSLSDLIDTSQKIIPVNGRMEIFSFAEKPIFIIDY
AHTPDALKKILDAIRLHYQKYIWCIFGCGGERDKKKRSIMGSIAEKMSDQVIITNDNPRN
EKEEKIIRDILNGCENKKKILIIQNRKKAISYAYFKAKYNHIILIAGKGHEEKQIIKNKY
INYSDKKTVLNLLEKKI
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaacttgtttaaaatatttattatcaccatggattaaaaatattccaaataaa
tatattttaaatttaaaaatggatagtagaactgtatgtaaaggagatttatttatagca
gttcgaggaaaaaagaaagatggacgtaattttatttttgaagctacttataaaaaagta
gcagcaattctatatgaaaccgaaaaaaaagaaaatcacggaatatttaaatatattaat
aatattcctattatatacttttttaagctatctgaaaatatatcaatgctagcaaatcgc
ttttataaagagccaggaaaaaaattaacaataattggtgtaactggtactaatggaaaa
actactgttatacaaatcattaatcaatggagtaatattttaggtaataaaatagcaact
atgggaactttaggaaatggttttgacaactccttgtctcctacaaaaaacacaacttct
tctcctctttttgttcattctttcttatctcaagctttaaataagcaagctaaattagtt
actatggaagtttcttcacatggtttgatagaaaaccgtgttaaagaagttcctttttat
attgcaatatttacaaatctaacacaagaccacttggattatcatgaaaatatgaagaag
tacgcatcagcaaaatggttattatttagtacgcataaagtcaaaaaaattatattaaat
gctgatgataaatatggaaaaatatggttaaaaaaactatttgattactatacgatagca
gttactattaaaaattctaaaccaagaaaatattctacaaaatggataaatgctacagat
atcaaaaattataacaattctattattattaaatttgaatcaagttggggggcaggtgaa
atatcatcttgtctaattggatattttaatgtgacaaatattttattagcattagcttgt
cttttagaattaggctatagtttgtctgatttaattgatacttctcaaaaaataatacct
gtaaatggtcgtatggaaatattttcttttgctgaaaaaccaatttttattattgattat
gctcatacacctgatgcattaaaaaaaatacttgatgcaattcgtttacattatcaaaaa
tatatatggtgtatatttggatgtggaggagaaagagataaaaaaaaacgttctattatg
ggatctattgcagaaaaaatgtcagatcaagttattattactaatgataatccaagaaat
gaaaaagaagaaaaaattatccgagacattttaaatggctgtgaaaataagaaaaaaata
ttaattattcaaaatagaaaaaaagcaatatcttatgcttattttaaagcaaaatacaat
catataattttaatagctggaaaaggacacgaagaaaaacaaataattaaaaataaatat
atcaattattcagataaaaaaacagtcttaaacttattggaaaaaaagatatga

DBGET integrated database retrieval system