KEGG   Buchnera aphidicola Ak: BAKON_279Help
Entry
BAKON_279         CDS       T01825                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bak  Buchnera aphidicola Ak (Acyrthosiphon kondoi)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bak00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BAKON_279 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAKON_279 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BAKON_279 (trpA)
Enzymes [BR:bak01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BAKON_279 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(302733..303542)
Genome map
AA seq 269 aa AA seqDB search
MNRYQIMFKRLSLLKEGCIIPFVVLGDPSLEISIKIIEALIENGADALEVGIPFSDPLAD
GPTIQKANLRALSKKNTFFEYFQILKKIREKNEKIPIGVLIYANLVYNQGIDNFYLQCFD
SGLDSVLIADVPIEESKVFYKTANKHQINSIFMCPPDADKNFLHKISSYAQGFIYVLSRA
GVTGIENKTFSLPTSFIKKIKKYNSIPLLQGFGISNPKQVKEAMLSGLSGIICGSAIIHI
IEKYLNQEDEMIKKIKRFINSLKLSSKLK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgatatcagataatgtttaaaagattatctttgttaaaagaaggatgtattata
ccttttgtggttttaggggatccttctttagaaatatcaataaaaattattgaagcattg
attgaaaatggagctgatgctttagaggttggaattccattttcagatccattagctgat
ggaccaactattcaaaaagcaaacttacgagccttatctaaaaaaaatactttttttgaa
tactttcaaatattaaaaaaaatacgcgaaaaaaatgaaaaaatacctattggtgttttg
atatatgccaatcttgtatataatcaaggtattgataatttttatttgcaatgttttgat
tctggtttagattctgttcttatagcagatgttccaattgaggaatcaaaagttttttat
aaaactgcaaataagcaccagattaattctatttttatgtgtcctccggatgcagataaa
aattttttacataaaatttcttcatatgcacaaggatttatttatgtattatctcgtgcg
ggagtaacaggtattgaaaataaaactttttcgttacctacaagttttataaaaaaaata
aaaaaatacaattctattcctttattacaaggttttggtatttcaaatcctaaacaagtt
aaagaagcaatgttatcaggtttatctggcataatatgtggttcagcaattatacatatt
attgaaaaatatttaaatcaagaagatgaaatgattaaaaaaataaaaagatttattaat
tcattaaaattgtctagtaaattaaaataa

DBGET integrated database retrieval system