KEGG   Buchnera aphidicola Ak (Acyrthosiphon kondoi): BAKON_280Help
Entry
BAKON_280         CDS       T01825                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bak  Buchnera aphidicola Ak (Acyrthosiphon kondoi)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bak00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BAKON_280 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAKON_280 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BAKON_280 (trpB)
Enzymes [BR:bak01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BAKON_280 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(303517..304725)
Genome map
AA seq 402 aa AA seqDB search
MTLLNPYFGEFGGMYVPQILMPALFELEKNFVSAQEDTDFQKKFHDLLKNYAGRPTPLTL
CRNLTKGTKTRIYLKREDLLHGGAHKTNQVLGQAMLAIRMKKKEIIAETGAGQHGVAAAI
ACALLNLKCRIYMGVKDVKRQSTNVFRMQLMGAKVISVKNGSGTLKDACNEALRDWSSTY
KTSHYMIGTAAGPHPYPTIVREFQKMIGEETKKQILEQENKLPNSIIACIGGGSNAIGIF
SDFIYDKVNLIGVEPAGHGIHTGKHGAPLKHGRTGIYFGMKSHLMQNQEGQIQESWSISA
GLDFPSVGPEHAWLNSTHRAQYVSITDQEAINAFQSLCREEGIIPALESSHALAYALKIM
KMHPQKKQILIVNLSGRGDKDIFTVHDVLKKGKKNESISDNV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtgactttactaaatccttattttggcgaatttggtggtatgtatgtacctcaaatatta
atgcctgctttatttgaattagaaaaaaattttgtttctgcacaagaagacactgatttt
caaaaaaaatttcatgatttattaaaaaattatgctggaagacccactccattgacttta
tgtagaaatttaaccaaaggtacaaaaacgcgtatttatctaaaaagagaagatttgcta
catggtggagcacataaaactaatcaagttttaggacaagctatgttggcaattagaatg
aaaaagaaagaaatcattgctgaaacaggtgctggtcaacatggtgtagctgctgctatt
gcttgtgcattgttaaatttaaaatgtagaatctacatgggagttaaagatgttaaaaga
caaagtacaaatgtttttcgcatgcaattaatgggtgcaaaagttatatcagtaaaaaat
ggttctggtacattaaaagatgcatgtaatgaagctttacgtgattggtctagtacttat
aaaacatctcattatatgattggtactgcagctggaccacatccttatcctactattgtt
cgtgaatttcagaaaatgattggagaagaaacaaaaaaacaaattttagaacaagaaaat
aagcttccaaattcaattattgcatgtatcggaggaggttccaatgcaattggaatattc
tcagattttatttatgataaagttaatctaattggtgtagaaccagcaggtcatggcata
catacaggaaaacatggagcaccattaaaacatggtagaactggtatttattttggtatg
aaatctcatttaatgcaaaatcaagagggacaaattcaagaatcttggtcgatttcagca
ggattagattttccgtctgtaggacctgaacatgcttggttaaatagcactcatcgtgct
caatatgtatctattactgatcaagaagcgatcaatgcatttcaatctttatgtagagaa
gaaggcattattcctgctttagaatcttctcatgccttagcatatgcattaaaaataatg
aaaatgcatcctcaaaaaaaacaaattttaattgttaatctttctggtcggggtgacaaa
gatatttttacagtgcatgatgttttaaaaaagggaaaaaagaatgaatcgatatcagat
aatgtttaa

DBGET integrated database retrieval system