KEGG   Buchnera aphidicola Ak (Acyrthosiphon kondoi): BAKON_305Help
Entry
BAKON_305         CDS       T01825                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bak  Buchnera aphidicola Ak (Acyrthosiphon kondoi)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bak00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAKON_305 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAKON_305 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BAKON_305 (sucB)
Enzymes [BR:bak01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BAKON_305 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
337294..338496
Genome map
AA seq 400 aa AA seqDB search
MKKINILVPDLPESVSDATVVKWHKKIGDTVNRDDNIVDIETDKVTLEVSSPCDGILKLI
LEEEGKIVKSRQILGEIKNVNIINNNILEEENNSLNRINNSTNKEEQEYLLEKKEKYLTP
SLRRLIKIDKNNTTNLEKIVKTQENISNNNLLNSNTLNLNEDNQKENKKFENRVKMTRLR
QRIAERLLDSKNNTAMLTTFNEVNMREIILLRKKYGQDFEKKYGIRIGFMSFFVKAVIQG
LKNFPEINAYIDKTDIVFYKNFDISIAISTPRGLITPVLRNADKMSMSEIEKKIKEFSDK
SIQNKINIKELIGGNFTITNGGVFGSLISTPIINPPQTAILGMHMIQERPVAVNGEIKIL
PMMYLALSYDHRLIDGKESVGFLVNIKNTLEDFTRILIDI
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataaatattcttgttccagatttaccggaatcggttagtgatgcaacagtt
gtaaaatggcataaaaaaataggagatacagttaatcgtgatgataatatagttgatatt
gaaacagataaagttacattagaagtatcctctccatgcgatggaatattaaaattaatt
ttagaagaagaagggaaaatagttaagtctcgacaaatactcggtgaaataaaaaatgta
aatattattaataataatattttagaagaagaaaataactcattaaatagaataaataat
tctacaaataaagaagagcaagaatatcttttagaaaaaaaagagaaatatcttactcca
tctctaagacgattaattaaaatagacaaaaataatacaactaatcttgaaaagattgta
aaaacacaagaaaacatatcgaataataacttattaaattctaatactttaaatcttaat
gaggataaccaaaaagaaaataaaaaatttgaaaatagagttaaaatgactcgcttacga
caaagaattgcagaacgattactagatagtaaaaataatacagctatgctaacaacattt
aatgaagtaaatatgcgcgaaataatacttttaagaaaaaagtatggccaagattttgaa
aaaaaatatggtattagaattggttttatgtctttttttgtaaaagcagtaattcagggt
ttgaagaattttccagaaataaatgcatatatagataaaacagatatagttttttataag
aattttgatataagtattgctatttcaacacctagaggattgataacaccagtcttaaga
aatgctgataaaatgtccatgtcagaaatagaaaaaaaaataaaggaattttctgataaa
agtattcaaaataaaattaatattaaagaattaatcggtggaaattttactatcacgaat
gggggtgtttttggttctttgatatctacacctattatcaatcctcctcaaacagctata
ttaggtatgcatatgattcaagaacggccagtagctgttaatggagaaattaaaattctt
cctatgatgtacctagcattatcttatgatcatcgtttaatagatggaaaagaatctgta
ggttttttagtgaatataaaaaatacattagaagattttactcgtattttaattgatatt
taa

DBGET integrated database retrieval system