KEGG   Buchnera aphidicola Ak (Acyrthosiphon kondoi): BAKON_305Help
Entry
BAKON_305         CDS       T01825                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bak  Buchnera aphidicola Ak (Acyrthosiphon kondoi)
Pathway
bak00020  Citrate cycle (TCA cycle)
bak00310  Lysine degradation
bak01100  Metabolic pathways
bak01110  Biosynthesis of secondary metabolites
bak01120  Microbial metabolism in diverse environments
bak01130  Biosynthesis of antibiotics
bak01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bak00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAKON_305 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BAKON_305 (sucB)
Enzymes [BR:bak01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BAKON_305 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: AEO08655
UniProt: G2LN17
Position
337294..338496
Genome map
AA seq 400 aa AA seqDB search
MKKINILVPDLPESVSDATVVKWHKKIGDTVNRDDNIVDIETDKVTLEVSSPCDGILKLI
LEEEGKIVKSRQILGEIKNVNIINNNILEEENNSLNRINNSTNKEEQEYLLEKKEKYLTP
SLRRLIKIDKNNTTNLEKIVKTQENISNNNLLNSNTLNLNEDNQKENKKFENRVKMTRLR
QRIAERLLDSKNNTAMLTTFNEVNMREIILLRKKYGQDFEKKYGIRIGFMSFFVKAVIQG
LKNFPEINAYIDKTDIVFYKNFDISIAISTPRGLITPVLRNADKMSMSEIEKKIKEFSDK
SIQNKINIKELIGGNFTITNGGVFGSLISTPIINPPQTAILGMHMIQERPVAVNGEIKIL
PMMYLALSYDHRLIDGKESVGFLVNIKNTLEDFTRILIDI
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataaatattcttgttccagatttaccggaatcggttagtgatgcaacagtt
gtaaaatggcataaaaaaataggagatacagttaatcgtgatgataatatagttgatatt
gaaacagataaagttacattagaagtatcctctccatgcgatggaatattaaaattaatt
ttagaagaagaagggaaaatagttaagtctcgacaaatactcggtgaaataaaaaatgta
aatattattaataataatattttagaagaagaaaataactcattaaatagaataaataat
tctacaaataaagaagagcaagaatatcttttagaaaaaaaagagaaatatcttactcca
tctctaagacgattaattaaaatagacaaaaataatacaactaatcttgaaaagattgta
aaaacacaagaaaacatatcgaataataacttattaaattctaatactttaaatcttaat
gaggataaccaaaaagaaaataaaaaatttgaaaatagagttaaaatgactcgcttacga
caaagaattgcagaacgattactagatagtaaaaataatacagctatgctaacaacattt
aatgaagtaaatatgcgcgaaataatacttttaagaaaaaagtatggccaagattttgaa
aaaaaatatggtattagaattggttttatgtctttttttgtaaaagcagtaattcagggt
ttgaagaattttccagaaataaatgcatatatagataaaacagatatagttttttataag
aattttgatataagtattgctatttcaacacctagaggattgataacaccagtcttaaga
aatgctgataaaatgtccatgtcagaaatagaaaaaaaaataaaggaattttctgataaa
agtattcaaaataaaattaatattaaagaattaatcggtggaaattttactatcacgaat
gggggtgtttttggttctttgatatctacacctattatcaatcctcctcaaacagctata
ttaggtatgcatatgattcaagaacggccagtagctgttaatggagaaattaaaattctt
cctatgatgtacctagcattatcttatgatcatcgtttaatagatggaaaagaatctgta
ggttttttagtgaatataaaaaatacattagaagattttactcgtattttaattgatatt
taa

DBGET integrated database retrieval system