KEGG   Buchnera aphidicola Ak (Acyrthosiphon kondoi): BAKON_306Help
Entry
BAKON_306         CDS       T01825                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bak  Buchnera aphidicola Ak (Acyrthosiphon kondoi)
Pathway
bak00010  Glycolysis / Gluconeogenesis
bak00260  Glycine, serine and threonine metabolism
bak00680  Methane metabolism
bak01100  Metabolic pathways
bak01110  Biosynthesis of secondary metabolites
bak01120  Microbial metabolism in diverse environments
bak01130  Biosynthesis of antibiotics
bak01200  Carbon metabolism
bak01230  Biosynthesis of amino acids
Module
bak_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bak00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAKON_306 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BAKON_306 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAKON_306 (gpmA)
Enzymes [BR:bak01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BAKON_306 (gpmA)
Membrane trafficking [BR:bak04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BAKON_306 (gpmA)
Exosome [BR:bak04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BAKON_306 (gpmA)
  Exosomal proteins of melanoma cells
   BAKON_306 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 MAF_flag10
Motif
Other DBs
NCBI-ProteinID: AEO08656
UniProt: G2LN18
Position
338666..339361
Genome map
AA seq 231 aa AA seqDB search
MTINKLVLIRHGQSEWNELNKFTGWHDAKLSKKGKYEAKSAAILLKKEKFFFDCAYTSVL
KRAIHTLQYILDELNQNWLSVKKSWRLNERHYGALEGLNKDEVIQKYGEKKVLLWRRSFE
TSPPHIDIKDKRFPGNDIRYSHLNINDIPIGESLEITAKRVIPYWNKIIYPQLKNNKKIL
VVAHGNSLRALIQHLNKIDNKEILKLNIPTATPIIIEFDQKNNPIKWYYLR
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgacaattaataaactagttttaatcagacatggtcaaagtgaatggaatgaattaaat
aaatttactggatggcatgatgctaaattatctaaaaaaggaaaatatgaagcaaaatct
gctgctatcttattaaaaaaagaaaaatttttttttgattgtgcatatacatctgtattg
aaaagagcaatacatacattgcaatatattttagatgaattaaatcagaattggttatca
gtaaaaaaatcttggcgtttaaatgaaagacattatggtgcattagaaggattaaataaa
gatgaagtcattcaaaaatatggagaaaaaaaagttctcttatggaggagaagttttgaa
actagtcctcctcatattgatatcaaagacaaacgttttccaggaaatgacatacgctat
tcccatttaaatatcaatgatattcctataggagagagtctagaaatcactgcaaaacga
gttataccttattggaataaaattatttatcctcaattaaaaaataataaaaaaatactt
gttgtagcacatggaaattctttgcgtgctttaatacaacatttaaataaaatagataat
aaagaaattttaaaattaaacatacctactgcaacacctattattatagaatttgatcaa
aaaaataatccaattaaatggtattatttaagataa

DBGET integrated database retrieval system