KEGG   Buchnera aphidicola Ak (Acyrthosiphon kondoi): BAKON_306Help
Entry
BAKON_306         CDS       T01825                                 

Gene name
gpmA
Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bak  Buchnera aphidicola Ak (Acyrthosiphon kondoi)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bak00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAKON_306 (gpmA)
   01230 Biosynthesis of amino acids
    BAKON_306 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAKON_306 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BAKON_306 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAKON_306 (gpmA)
Enzymes [BR:bak01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BAKON_306 (gpmA)
Exosome [BR:bak04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BAKON_306 (gpmA)
  Exosomal proteins of melanoma cells
   BAKON_306 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
338666..339361
Genome map
AA seq 231 aa AA seqDB search
MTINKLVLIRHGQSEWNELNKFTGWHDAKLSKKGKYEAKSAAILLKKEKFFFDCAYTSVL
KRAIHTLQYILDELNQNWLSVKKSWRLNERHYGALEGLNKDEVIQKYGEKKVLLWRRSFE
TSPPHIDIKDKRFPGNDIRYSHLNINDIPIGESLEITAKRVIPYWNKIIYPQLKNNKKIL
VVAHGNSLRALIQHLNKIDNKEILKLNIPTATPIIIEFDQKNNPIKWYYLR
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgacaattaataaactagttttaatcagacatggtcaaagtgaatggaatgaattaaat
aaatttactggatggcatgatgctaaattatctaaaaaaggaaaatatgaagcaaaatct
gctgctatcttattaaaaaaagaaaaatttttttttgattgtgcatatacatctgtattg
aaaagagcaatacatacattgcaatatattttagatgaattaaatcagaattggttatca
gtaaaaaaatcttggcgtttaaatgaaagacattatggtgcattagaaggattaaataaa
gatgaagtcattcaaaaatatggagaaaaaaaagttctcttatggaggagaagttttgaa
actagtcctcctcatattgatatcaaagacaaacgttttccaggaaatgacatacgctat
tcccatttaaatatcaatgatattcctataggagagagtctagaaatcactgcaaaacga
gttataccttattggaataaaattatttatcctcaattaaaaaataataaaaaaatactt
gttgtagcacatggaaattctttgcgtgctttaatacaacatttaaataaaatagataat
aaagaaattttaaaattaaacatacctactgcaacacctattattatagaatttgatcaa
aaaaataatccaattaaatggtattatttaagataa

DBGET integrated database retrieval system