KEGG   Buchnera aphidicola Ak: BAKON_307Help
Entry
BAKON_307         CDS       T01825                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bak  Buchnera aphidicola Ak
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:bak01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bak01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bak00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bak00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bak00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism
Metabolism; Energy metabolism; Methane metabolism [PATH:bak00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
339563..340525
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRTALSERLEVFGIYDGYLGLYENRMVNLDRYSVSD
MINRGGTFLGSARFSDFHQDKIRSIAVQNVKKRKIDALVVIGGDGSYIGAQKLTEMGVPC
ISIPGTIDNDVSGTDYTIGYFTALQTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFIVLPEIDYKKEELVIEIQAGIAKGKKHAIVAITEYICDVEALARYIEKKTN
RETRATILGHIQRGGSPVVYDRILASRMGAYSVELLIKGYQGKCVGIQNEKMVFNDIRSA
LKNMKRTFKKDWLITAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaattggagtcttaaccagtggtggagatgctccagggatgaatgctgca
attagaggagttgttagaacagcacttagtgagagattagaagtctttggaatttatgat
ggatatttaggtttatatgaaaaccgtatggtaaacctcgatagatacagtgtatctgat
atgatcaatagaggtggaacatttttaggatcagctagattttctgattttcatcaagat
aaaatacgatctattgcagtacaaaatgtaaaaaaaagaaaaatagatgctcttgttgtt
atcggaggcgacggatcgtatataggagctcaaaaattaacagaaatgggtgttccatgt
attagtattccaggtactatagataatgatgtttcaggtactgattatacaataggttat
tttactgctttacaaacagttgttgaagctattgatagattacgtgacacctcatcttct
catcaacgtatttctatagtagaagtaatgggtagatattgtggagatttaacattagct
gcagctattgctggtggatgtgaatttattgtactaccagaaattgactataaaaaagaa
gaattagttattgaaatccaagcaggtattgctaaaggaaaaaaacatgctattgttgca
ataacagaatatatttgtgatgtagaagcattagcacgatatattgaaaaaaaaacaaat
cgagaaactagagctacaatccttggacatattcaaagaggtggatcccctgtagtatat
gatcgaatattagcttcaagaatgggtgcatattcagttgaactattaataaaaggttat
caaggtaaatgtgttggaatacaaaacgaaaagatggtttttaatgatataagaagtgca
ctaaaaaatatgaaacgtacttttaaaaaagattggttaattactgctaaaaagttatat
taa

DBGET integrated database retrieval system