KEGG   Buchnera aphidicola Ak (Acyrthosiphon kondoi): BAKON_307Help
Entry
BAKON_307         CDS       T01825                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bak  Buchnera aphidicola Ak (Acyrthosiphon kondoi)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bak00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAKON_307 (pfkA)
   01230 Biosynthesis of amino acids
    BAKON_307 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAKON_307 (pfkA)
   00030 Pentose phosphate pathway
    BAKON_307 (pfkA)
   00051 Fructose and mannose metabolism
    BAKON_307 (pfkA)
   00052 Galactose metabolism
    BAKON_307 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BAKON_307 (pfkA)
Enzymes [BR:bak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BAKON_307 (pfkA)
Protein phosphatases and associated proteins [BR:bak01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BAKON_307 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
339563..340525
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRTALSERLEVFGIYDGYLGLYENRMVNLDRYSVSD
MINRGGTFLGSARFSDFHQDKIRSIAVQNVKKRKIDALVVIGGDGSYIGAQKLTEMGVPC
ISIPGTIDNDVSGTDYTIGYFTALQTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFIVLPEIDYKKEELVIEIQAGIAKGKKHAIVAITEYICDVEALARYIEKKTN
RETRATILGHIQRGGSPVVYDRILASRMGAYSVELLIKGYQGKCVGIQNEKMVFNDIRSA
LKNMKRTFKKDWLITAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaattggagtcttaaccagtggtggagatgctccagggatgaatgctgca
attagaggagttgttagaacagcacttagtgagagattagaagtctttggaatttatgat
ggatatttaggtttatatgaaaaccgtatggtaaacctcgatagatacagtgtatctgat
atgatcaatagaggtggaacatttttaggatcagctagattttctgattttcatcaagat
aaaatacgatctattgcagtacaaaatgtaaaaaaaagaaaaatagatgctcttgttgtt
atcggaggcgacggatcgtatataggagctcaaaaattaacagaaatgggtgttccatgt
attagtattccaggtactatagataatgatgtttcaggtactgattatacaataggttat
tttactgctttacaaacagttgttgaagctattgatagattacgtgacacctcatcttct
catcaacgtatttctatagtagaagtaatgggtagatattgtggagatttaacattagct
gcagctattgctggtggatgtgaatttattgtactaccagaaattgactataaaaaagaa
gaattagttattgaaatccaagcaggtattgctaaaggaaaaaaacatgctattgttgca
ataacagaatatatttgtgatgtagaagcattagcacgatatattgaaaaaaaaacaaat
cgagaaactagagctacaatccttggacatattcaaagaggtggatcccctgtagtatat
gatcgaatattagcttcaagaatgggtgcatattcagttgaactattaataaaaggttat
caaggtaaatgtgttggaatacaaaacgaaaagatggtttttaatgatataagaagtgca
ctaaaaaatatgaaacgtacttttaaaaaagattggttaattactgctaaaaagttatat
taa

DBGET integrated database retrieval system