KEGG   Buchnera aphidicola Ak (Acyrthosiphon kondoi): BAKON_309Help
Entry
BAKON_309         CDS       T01825                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bak  Buchnera aphidicola Ak (Acyrthosiphon kondoi)
Pathway
bak00010  Glycolysis / Gluconeogenesis
bak00051  Fructose and mannose metabolism
bak00562  Inositol phosphate metabolism
bak01100  Metabolic pathways
bak01110  Biosynthesis of secondary metabolites
bak01120  Microbial metabolism in diverse environments
bak01130  Biosynthesis of antibiotics
bak01200  Carbon metabolism
bak01230  Biosynthesis of amino acids
Module
bak_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bak00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAKON_309 (tpiA)
   00051 Fructose and mannose metabolism
    BAKON_309 (tpiA)
   00562 Inositol phosphate metabolism
    BAKON_309 (tpiA)
Enzymes [BR:bak01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BAKON_309 (tpiA)
Exosome [BR:bak04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BAKON_309 (tpiA)
  Exosomal proteins of bladder cancer cells
   BAKON_309 (tpiA)
  Exosomal proteins of melanoma cells
   BAKON_309 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEO08659
UniProt: G2LN21
Position
complement(341394..342158)
Genome map
AA seq 254 aa AA seqDB search
MKKFFIAANWKLNGNINMISNFFKYLKLQSSIHSKKNTIIIAPPTIYLERVYKDVSNMNI
FLGAQNIDIHLKGAFTGETSVLMLEDIGVKYVIIGHSERRLMHNETNDIIIKKFHLIKES
NLIPILCIGETEIDKKNGKTQEVITEQLHDIFKKIGKSAFKNTIIAYEPIWAIGTGLSAE
PKDVQLIHKFIKNYIVKHDSIDINDIIVQYGGSINYSNAKKFMEQPDINGLLIGNASLDP
AEFCRIIKISDHIL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattttttattgcagctaattggaaattaaacggcaatataaatatgatttct
aatttttttaaatatttaaaattacaatcatcaattcattcaaaaaagaatacaattatt
attgctcctccaactatatatttagaacgagtatacaaggatgtaagtaacatgaatatt
tttcttggtgcacaaaatatagatattcatttaaaaggagcctttactggtgaaacatca
gttttaatgctagaagacataggagtaaaatatgttatcattggacattctgaaagacgt
ttaatgcataatgaaactaatgatattattataaaaaaatttcatttaattaaagagtca
aacttaataccgattttatgtatcggtgaaacagaaatagataaaaaaaatggcaaaact
caagaagttattacagaacaattacatgatatatttaaaaaaataggcaaatcagcattt
aaaaatactataattgcttatgaacctatttgggctattggaacaggtttatcagctgaa
cctaaagatgtacaattaatacataaatttataaaaaattacattgtaaaacatgattca
attgatataaatgatataatagttcagtatggaggttctattaattattctaatgcaaaa
aaatttatggagcaaccagatatcaatggtttgttaattggaaatgcttctttagatcct
gcagaattttgtagaattattaaaatatctgatcatattctttaa

DBGET integrated database retrieval system