KEGG   Buchnera aphidicola Ak (Acyrthosiphon kondoi): BAKON_309Help
Entry
BAKON_309         CDS       T01825                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bak  Buchnera aphidicola Ak (Acyrthosiphon kondoi)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bak00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAKON_309 (tpiA)
   01230 Biosynthesis of amino acids
    BAKON_309 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAKON_309 (tpiA)
   00051 Fructose and mannose metabolism
    BAKON_309 (tpiA)
   00562 Inositol phosphate metabolism
    BAKON_309 (tpiA)
Enzymes [BR:bak01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BAKON_309 (tpiA)
Exosome [BR:bak04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BAKON_309 (tpiA)
  Exosomal proteins of bladder cancer cells
   BAKON_309 (tpiA)
  Exosomal proteins of melanoma cells
   BAKON_309 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(341394..342158)
Genome map
AA seq 254 aa AA seqDB search
MKKFFIAANWKLNGNINMISNFFKYLKLQSSIHSKKNTIIIAPPTIYLERVYKDVSNMNI
FLGAQNIDIHLKGAFTGETSVLMLEDIGVKYVIIGHSERRLMHNETNDIIIKKFHLIKES
NLIPILCIGETEIDKKNGKTQEVITEQLHDIFKKIGKSAFKNTIIAYEPIWAIGTGLSAE
PKDVQLIHKFIKNYIVKHDSIDINDIIVQYGGSINYSNAKKFMEQPDINGLLIGNASLDP
AEFCRIIKISDHIL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattttttattgcagctaattggaaattaaacggcaatataaatatgatttct
aatttttttaaatatttaaaattacaatcatcaattcattcaaaaaagaatacaattatt
attgctcctccaactatatatttagaacgagtatacaaggatgtaagtaacatgaatatt
tttcttggtgcacaaaatatagatattcatttaaaaggagcctttactggtgaaacatca
gttttaatgctagaagacataggagtaaaatatgttatcattggacattctgaaagacgt
ttaatgcataatgaaactaatgatattattataaaaaaatttcatttaattaaagagtca
aacttaataccgattttatgtatcggtgaaacagaaatagataaaaaaaatggcaaaact
caagaagttattacagaacaattacatgatatatttaaaaaaataggcaaatcagcattt
aaaaatactataattgcttatgaacctatttgggctattggaacaggtttatcagctgaa
cctaaagatgtacaattaatacataaatttataaaaaattacattgtaaaacatgattca
attgatataaatgatataatagttcagtatggaggttctattaattattctaatgcaaaa
aaatttatggagcaaccagatatcaatggtttgttaattggaaatgcttctttagatcct
gcagaattttgtagaattattaaaatatctgatcatattctttaa

DBGET integrated database retrieval system