KEGG   Buchnera aphidicola Ak (Acyrthosiphon kondoi): BAKON_458Help
Entry
BAKON_458         CDS       T01825                                 

Gene name
recD
Definition
exodeoxyribonuclease V 67 kDa polypeptide
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bak  Buchnera aphidicola Ak (Acyrthosiphon kondoi)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bak00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BAKON_458 (recD)
Enzymes [BR:bak01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BAKON_458 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
501577..503373
Genome map
AA seq 598 aa AA seqDB search
MIILLKKAVKLKIIRPIDFYFSQFVAQKNTIVMLVAACVSYENNKGHIFLPIKYFEKNCF
FSSSNENFIKKILIILKKKINWSVELLKHASISNGSIPTPLVLYEKKIYLYKMWKSENNI
FNHLYIKNKKNKINFIKCSKILDNLFSDKTINFQKIAVALTLINSITFILGGPGTGKTTT
ILKIIIALIKSSKTEIKIQLSAPTGKATTRLNQIINNNIFDLYLSEKEKRSLPSRATTIH
QLLGIQKISQNSFFNKNNLLNLDVLIIDEISMVDILMMEKILFSVSKYTKLIFIGDHNQL
CPIESGSILRKICNYNYNRYSLKTIMNIEKLTQYKLLKKINKKTTTFISNSICILKKNYR
FEKNSGIYFLSNAICHKKTKIIESLFNNLIENVFFYETNSIQKYKKMITRIVSNYQFFWE
KIYKKATIKEIIESFQDYQVLCVLHDGLFGVNILNKKLEENMYQKNMIKYFYINGEQWYV
GKPVMITDNNKYLDVFNGNIGITNINKNGVLQVSFLKENNIINNIPVKILRNYKTAWAIT
VHKAQGSEFMHTALILPDFNSHVLNKDILYTGITRSRKILSIFSDKEIFIKTALKNTD
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgattatattattaaaaaaagctgtaaaattaaagattatacgtccaattgatttttat
ttttctcagtttgtagcccaaaagaacaccattgttatgttagttgctgcttgtgtaagt
tatgaaaacaataaaggacacatttttctaccaattaaatattttgaaaaaaattgtttt
ttttcaagttcgaatgaaaattttataaaaaaaatattaataattcttaaaaaaaaaata
aattggtctgttgagttattgaaacacgcatctattagtaacggatctatccctacacct
ttagtcttatacgagaaaaaaatatacctgtataaaatgtggaaatctgaaaataatatt
tttaaccatttgtatataaaaaacaaaaaaaataaaattaatttcataaaatgttctaaa
atattagataatttattttctgataaaactattaattttcaaaaaatagcagtagcgcta
actttaataaattctataacttttattcttggtggtcctggaaccggaaaaacaactact
atattaaaaataatcattgcattaattaaaagttcaaaaacagagattaaaattcaatta
tctgcaccaacagggaaagcaacgacacgtttaaatcaaataataaacaataatattttt
gatctttatttatctgaaaaagaaaaacgttcacttccatcaagagctacaactatacat
caactattaggaattcaaaaaatatcacaaaatagcttttttaataaaaataatttatta
aatttagatgttttaattattgatgaaatctcaatggtagatattttaatgatggaaaaa
atattattttcagtttcaaaatatactaaattaatttttataggagatcacaatcaatta
tgcccaatagaatcaggttcgattctaagaaaaatttgtaattacaactataatagatat
agtttgaaaactataatgaatattgaaaaacttacgcagtataaactattaaaaaaaata
aataaaaaaacaacaacatttatcagtaatagtatatgtattttaaaaaaaaactataga
tttgaaaaaaattcaggaatttattttttatcaaatgctatttgtcataaaaaaacaaaa
attattgaaagtctatttaataatttaatagaaaatgtttttttttacgaaacgaattct
attcaaaaatataaaaaaatgattacaagaatagtttcaaactatcaatttttttgggaa
aaaatatataaaaaagcaacaatcaaagaaattatagaatcttttcaagattatcaagtg
ttatgtgtattacatgatggtttatttggtgtaaatattttaaataaaaagttagaagaa
aatatgtatcaaaaaaatatgattaaatatttctatattaatggagaacaatggtatgta
ggaaaacccgtaatgattactgataataacaaatatttagatgtgtttaatggaaatata
ggcattacaaatattaataaaaacggtgttttacaagtatctttcttgaaagaaaacaat
ataattaataacattcctgtaaaaattttaagaaattataaaactgcttgggctattact
gttcataaagcacaaggttcagaatttatgcatacagctttaatattaccagattttaat
tcacatgttttaaataaagatattttatatactggtataacaagatctcgaaaaatattg
agtattttttcagataaagaaatatttataaaaactgctttaaaaaatacagattaa

DBGET integrated database retrieval system