KEGG   Bacillus cereus biovar anthracis CI: BACI_c00520Help
Entry
BACI_c00520       CDS       T01279                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
bal00900  Terpenoid backbone biosynthesis
bal01100  Metabolic pathways
bal01110  Biosynthesis of secondary metabolites
bal01130  Biosynthesis of antibiotics
Module
bal_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bal00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BACI_c00520 (ispE)
Enzymes [BR:bal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BACI_c00520 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADK02854
UniProt: D8GWJ1
Position
47715..48584
Genome map
AA seq 289 aa AA seqDB search
MKLLVKAPAKINLSLDVLGKRQDGYHEVKMIMTTIDLADRLELMELAEDRIEILSHNRYV
PDDQRNLAYQAAKLLKEKFNVKKGVSITIEKTIPVAAGLAGGSSDAAATLRGLNKLWNLG
LTIDQLAELGAEIGSDVSFCVYGGTAIATGRGEQIEHIKTPPSCWVILAKPHIGVSTADV
YGNLKLNRVTHPNVDEMVDVINAGDYKGICDTVGNVLEDVTFAMHPEVARIKAQMKRFGA
DAVLMSGSGPTVFGLVHHDSRMHRIYNGLKGFCEQVYAVRLLGERETLE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
ttgaagctactagtgaaagcaccagcaaagattaatctgtcgttagatgtactgggaaaa
agacaagacggatatcatgaagtgaaaatgattatgacaacaatcgatttagcggatcgt
ttagaactaatggaattagcagaagaccgtattgaaattttatcccataatcggtatgtc
ccagacgaccaaagaaatctggcttatcaagcagcgaaattattaaaagagaagtttaat
gtgaaaaaaggtgtatctattactattgaaaaaacgattccagtagcagctggattagcg
ggtggaagtagtgatgcagcagcgacattacgtggtcttaataaattatggaatttaggc
cttacaattgatcaattagcagagcttggcgcagaaattggatcagatgtatcgttttgt
gtatatggtgggacagcaattgccactggaagaggagagcagattgagcacataaaaact
ccaccttcttgttgggttattttagcaaagcctcatattggtgtatctactgctgatgta
tatggaaatttaaagttaaatcgagttacacatccaaatgtagatgaaatggtggatgtc
ataaacgctggagactacaaagggatttgcgatactgttggtaacgttttagaagatgta
acgtttgctatgcatcctgaagttgcacgcattaaagcacaaatgaagcgatttggagca
gatgctgtattaatgagtggaagtggtccaactgtattcggcctagtgcaccatgattcg
cgaatgcatcgtatatataacggattaaaaggattttgtgaacaagtatacgcagtacgt
ttattaggagagcgagaaacgcttgaataa

DBGET integrated database retrieval system