KEGG   Bacillus cereus biovar anthracis CI: BACI_c01130Help
Entry
BACI_c01130       CDS       T01279                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bal00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    BACI_c01130 (gltX)
Enzymes [BR:bal01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     BACI_c01130 (gltX)
Amino acid related enzymes [BR:bal01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   BACI_c01130 (gltX)
Transfer RNA biogenesis [BR:bal03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BACI_c01130 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
102635..104092
Genome map
AA seq 485 aa AA seqDB search
MEKQVRVRYAPSPTGHLHIGNARTALFNYLFARHQDGKFIIRIEDTDVKRNVAGGEESQL
KYLKWLGMDWDEGVDVGGEFGPYRQTERLDIYKKLYEDLLERGLAYKCYMTEEELEAERE
GQIARGETPRYAGNHRDLTEAQVKAFEAEGRIPSIRFRVPADRDYTFKDIVKDEVAFHSN
DFGDFVIVKKDGIPTYNFAVAVDDHLMEITHVLRGDDHISNTPKQMMIYEAFGWDIPQFG
HMTLIVNESRKKLSKRDESIIQFIEQYKELGYLPEAIFNFIALLGWSPVGEEEIFSQEEF
IKMFDAARLSKSPALFDSQKLKWMNNQYMKKQDLDTVVELSLPHLVKAGRIGETLSEQEQ
AWIRDVIALYHEQMSFGAEIVELSEMFFKDHVDYEEEGQEVLKGEQVPEVLRAFAGQVEA
LEAMEPAAIKAAIKAVQKETGHKGKNLFMPIRVATTGQTHGPELPNAIALLGKEKVLNRL
QKVIG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagcaagtgagagtgcgctatgcgccaagtccaacaggacacttacatatcgga
aatgcgcgtacggcattatttaattatttatttgctcgtcatcaagatggtaagtttatt
attcgtattgaagatactgatgtaaaacgtaatgttgctggtggagaagaaagccaatta
aaatacttgaaatggctcggtatggactgggatgaaggtgttgatgttggtggtgaattt
ggaccatatcgtcaaacagagcgtttagatatttataaaaagttatatgaagatttatta
gagcgtggtttagcttacaaatgttatatgacagaagaagagctagaggcagaacgcgaa
gggcaaattgctcgcggtgaaacacctcgttacgcaggcaaccaccgtgatttaactgaa
gcgcaagtgaaagcatttgaagctgagggacgtattccaagtattcgtttccgcgtacca
gctgaccgtgattacacatttaaagatattgtaaaagatgaagttgcattccattcaaat
gatttcggtgattttgttatcgtgaaaaaagatgggattccaacttataactttgcagta
gcagtagatgatcacttaatggaaattacacacgtacttcgtggtgatgaccatatttca
aacacgccaaaacaaatgatgatttatgaagctttcggttgggatattccgcaattcggt
catatgactttaattgtaaatgaaagccgtaaaaaattaagtaagcgtgatgaatctatt
attcaatttattgagcaatataaagagcttggatatcttccagaagcaatctttaacttt
attgcactactaggttggtcgccagtaggagaagaagaaatcttctctcaagaagagttt
atcaaaatgtttgatgcagctcgtttatcaaaatcacctgcattatttgattctcaaaaa
ctaaaatggatgaacaaccaatatatgaaaaagcaagatttagatacggtggtagaatta
agcttaccgcatttagtgaaggctggacgtataggtgaaactttaagtgaacaagaacaa
gcttggattcgtgatgtaattgcgttatatcatgaacaaatgagctttggagctgaaatt
gtagagctttctgaaatgttcttcaaagatcacgttgattatgaagaagaaggacaagaa
gtattaaaaggtgaacaagtaccagaagtacttcgtgcatttgctggtcaagtagaagca
ctagaagctatggaaccggcagcaattaaggcggctattaaagcggttcaaaaggaaaca
ggtcataaaggtaaaaacttatttatgccaatccgtgttgcaactactggtcaaacacat
ggcccagagcttcctaatgctattgcacttcttggaaaagaaaaagttttaaatcgtctt
caaaaagtaattggttaa

DBGET integrated database retrieval system