KEGG   Bacillus cereus biovar anthracis CI: BACI_c10650Help
Entry
BACI_c10650       CDS       T01279                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bal00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1004989..1006479
Genome map
AA seq 496 aa AA seqDB search
MKKYILSLDQGTTSSRAILFNKKGEIVHSAQKEFTQHFPKPGWVEHNAQEIWGSILAVIA
TCLSEADVKPEQIAGIGITNQRETAVVWDKTTGKPIYNAIVWQSRQTAEICDELKEKGYS
EMVREKTGLLIDAYFSGTKVKWILDNVEGAREKAENGDLLFGTIDTWLVWKLSGGKAHVT
DYSNASRTLMFNIHDLQWDDELLDMLTVPKSMLPEVRPSSEVYGETIDYHFFGQNVPIAG
VAGDQQAALFGQACFGEGMAKNTYGTGCFMLMNTGEKAVASEHGLLTTIAWGIDGKVNYA
LEGSIFVAGSAIQWLRDGMRMFKDASESEVYASRVESTDGVYVVPAFVGLGTPYWDSEVR
GAMFGVTRGTTKEHFIRATLESLAYQTKDVLCAMEADSGIELKTLRVDGGAVKNNFLMKF
QSDILDVPVERPVINETTALGAAYLAGLAVGYWKNQDEIKEQWHMDKRFEPTMEAETSEE
LYAGWKKAIEATKAFK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatatattctttcattagaccaaggaacaactagctcacgcgcaattcttttc
aataaaaaaggtgaaattgttcattcagctcaaaaagaatttacacaacattttccaaag
ccaggctgggtagagcataacgcgcaagaaatttggggatctattttagcggttatcgca
acttgcttaagtgaagcagatgtaaagccagaacaaatcgctggtatcggtattacgaac
caacgtgaaacagcggttgtatgggataaaacgactggtaaaccaatttataacgcaatt
gtatggcaatctcgccaaacagctgaaatttgtgatgagttaaaagaaaaaggttatagc
gaaatggttcgcgaaaaaacaggtcttttaattgacgcatacttctctggtacgaaagta
aaatggattttagataacgttgaaggtgcaagagagaaagcagaaaacggcgatctatta
ttcggaacaattgatacgtggcttgtatggaaattatctggtggtaaagcgcacgtaacg
gattactcaaatgcatcacgtacattaatgtttaacattcacgacttacagtgggatgat
gaacttctagacatgttaacagtaccaaagagcatgcttccagaagtacgtccatcatct
gaagtgtatggagaaacaattgactatcacttcttcggtcaaaatgtaccgattgcaggt
gtagctggtgatcaacaagcggcattatttggacaagcttgtttcggtgaaggtatggcg
aaaaatacttacggaactggttgcttcatgttaatgaatactggtgaaaaagcagtagct
tctgagcacggcctattaacaacaattgcatggggaatagatggtaaagtaaactacgca
ttagaaggaagtattttcgtagcgggttctgccattcagtggttacgtgacggaatgcgc
atgtttaaagatgcaagtgagagtgaagtatatgcttctcgtgttgaatcaactgacggt
gtatacgttgtaccagcattcgtaggattaggtacgccttactgggatagtgaagtacgc
ggcgctatgtttggtgtaacgcgcggtacgacgaaagaacacttcattcgtgcaacatta
gaatctttagcttaccaaacaaaagacgtattatgcgcaatggaagcagattcaggtatt
gaactaaaaacattacgcgttgatggcggagcagttaaaaataacttcttaatgaagttc
caaagtgatattttagacgttcctgtagagcgtccagtgatcaatgaaacaacagcttta
ggtgcagcgtacttagctggtcttgcggttggatattggaaaaaccaagatgaaattaaa
gaacagtggcatatggacaaacgctttgagccaacgatggaagcggaaacaagcgaagag
ctatatgctggatggaaaaaagcaattgaagcaacaaaagctttcaaataa

DBGET integrated database retrieval system