KEGG   Bacillus cereus biovar anthracis CI: BACI_c11130Help
Entry
BACI_c11130       CDS       T01279                                 

Gene name
hemY1
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bal00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1049200..1050621
Genome map
AA seq 473 aa AA seqDB search
MRKKVVIIGGGITGLTTMYHLQKDIRDKNLPIDTLLIEASGKLGGKIQTVRKDGFTIERG
PDSFLARKESAARLVKELGLGDELVNNEAGQSFILVNNRLHKMPSGSMMGIPTQITPFLF
SGLFSPIGKLRAGFDLLMPRSKPVSDQSLGHFFRHRLGNEVVENLIEPLLCGIYAGDIDE
MSLMSTFPQMYQIEQKHRSISLGMRTLAPKAEKAEPKKGIFQTVKTGLESIVESLELKMH
EGTIIKGTRIEKVAKQGDGYAITLSNGKEIEADAVVVASSHKVLPSMFAQYKQFRFFRNI
PSTSVANVAMAFPKSAIQRDIDGTGFVVSRNSDYTITACTWTHKKWPHTTPEGKTLLRCY
VGRPGDEAVVEQTEEELVQLVLEDLRKTMDITEDPEFTIVSRWKEAMPQYTVGHNERMKK
LTTFMEKELPGIYLAGSSYAGSGLPDCIDQGEKAAKRVLSHLEKVMNTELIAQ
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
ttgaggaaaaaagttgtaatcatcggcggtggcatcacaggattaacaacaatgtatcac
ttacaaaaagatattcgtgacaagaacttgccgatcgatacattactgatagaagcatcg
ggtaaacttggcgggaaaattcaaaccgttcgaaaagatggatttacaattgaacgcgga
ccggattctttcttagcacgaaaagaaagtgcagctagattagtgaaagaattaggtctt
ggcgatgagcttgtaaataatgaggccggtcaatcatttatcctcgtaaacaatcggtta
cataaaatgccgagcggatcaatgatgggaattccaacgcaaattacgccgtttctattt
tctgggctgttctccccaattgggaaactaagagctggttttgatctattaatgccaaga
tcaaaaccagtatctgaccaatcactcgggcactttttcagacatcgcctcggaaatgaa
gtggttgaaaatttaatagaaccattactatgtggtatttatgcaggggatattgatgaa
atgagtttaatgtcaacattcccgcaaatgtatcaaattgagcagaaacatcgcagtatt
tcactcggtatgcgtacgctcgccccgaaagcagagaaagctgaaccgaaaaagggaatc
ttccaaacagtgaaaactggtttagaatctatcgtagaatctctcgaattgaagatgcat
gaaggtacgataataaagggaactcgcatagaaaaagttgcaaaacagggtgatggctat
gcgattactcttagtaacggaaaagaaatagaagcggacgcggtcgtagtggcaagctca
cataaagtattgccatctatgtttgcgcagtacaagcagtttcgtttcttccgcaacatt
ccatccacatcagttgcgaatgtggcaatggctttcccaaaatcagctattcagcgtgat
attgatggtacaggatttgttgtatctagaaatagtgattacacaattacagcatgtacg
tggacgcataaaaagtggccacatacaacgccagaaggaaaaacgcttcttcgatgttac
gttggacgacctggggatgaagcggttgtagaacaaacagaagaggaactcgttcagctc
gtactagaagacttacgaaagacgatggatattacagaggatccagagtttacaatcgta
agtcgctggaaagaagcgatgccccaatatacagtaggccataacgagcgaatgaagaaa
ctcacaacatttatggagaaagagttgccaggtatatacttggcaggtagttcttacgct
ggttctggtcttccggactgtattgatcaaggtgagaaagccgcaaagcgtgtactctct
catttggagaaagtaatgaatacggaattaatcgcacaataa

DBGET integrated database retrieval system