KEGG   Bacillus cereus biovar anthracis CI: BACI_c11610Help
Entry
BACI_c11610       CDS       T01279                                 

Gene name
aceA
Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BACI_c11610 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BACI_c11610 (aceA)
Enzymes [BR:bal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BACI_c11610 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1095655..1096932
Genome map
AA seq 425 aa AA seqDB search
MKNERIEKLQESWELDTRWKGITRPYSAEDVIRLRGSIDIEHTLARRGAEKLWASLHTED
YINALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLSGHMYPDQSLYPANSVPAVVKRI
NQTLQRADQIQHMEGSGDTDYFVPIVADAEAGFGGQLNVFELMKGMIEAGASGVHFEDQL
SSEKKCGHLGGKVLLPTQTAVRNLISARLAADVMGVPTIIVARTDADAADLITSDIDPVD
KAFITGERTPEGFYRTKAGLDQAIARGLAYAPYADLVWCETSEPNLEDAKRFADAIHKEH
PGKLLAYNCSPSFNWKQKLDEKTIASFQKEIASYGYKFQFVTLAGFHSLNYGMFELARGY
KERGMAAYSELQQAEFAAEKHGYSATRHQREVGTGYFDEVAQVITGGTSSTTALKGSTEE
AQFTK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgaaagaatcgagaaattacaagagagctgggaattagatacgcgttggaaa
gggattacacgtccatattcggcagaagatgtaattcgcctgcgcggatcaattgatatc
gagcatacattagcgcgccgcggtgctgaaaagctttgggcatcgcttcatacagaagat
tacattaacgcacttggggcattaacaggaaaccaagcgatgcaacaagtaaaagctggg
ttaaaagcaatttatttaagtggatggcaagtagcggccgatgcaaacctgtctggacat
atgtatccagaccaaagtttatatccagcgaacagcgtacctgctgtcgtaaaacgaatt
aatcaaacacttcaacgtgcggatcaaattcagcatatggaaggaagcggtgatacagat
tatttcgtgccgattgtagcagatgcagaagctgggtttggcggacaattaaacgtattt
gaactgatgaaaggtatgattgaagcgggtgcgtctggcgtgcactttgaagatcaatta
tcttcagagaagaaatgcggtcatttaggcggaaaagtattactaccaacgcaaacagcg
gtgcgtaatttaatttcggcacgccttgcggcagacgtaatgggagtgccgacaattatc
gttgcaagaacagatgcggatgcagcagatttaattacgagcgatatcgatcctgttgat
aaagcgtttattacaggagaaagaacaccagaaggattttaccgtacgaaagcaggtctt
gaccaagcgattgcacgtggtttagcgtacgctccttacgcagacctcgtttggtgtgaa
acatctgaaccaaatttagaagatgcaaaacgatttgcggacgcaattcataaagagcat
ccagggaaattgcttgcatataactgttcaccttcatttaactggaaacaaaaactagat
gagaaaacaattgcgagcttccaaaaagaaatcgcatcttacggttataagttccagttc
gtaacacttgctggattccattcattaaactacggcatgttcgaattagcacgcggctat
aaagagcgcggcatggcagcgtactctgaactacaacaagcagaattcgcagcagaaaaa
catggctactctgcaactcgtcaccaacgagaagtaggaacaggttactttgatgaagta
gcacaagtcattacaggcggtacttcatcaacaacagcgctaaaaggatctacagaagaa
gcacaatttacgaaataa

DBGET integrated database retrieval system