KEGG   Bacillus cereus biovar anthracis CI: BACI_c11910Help
Entry
BACI_c11910       CDS       T01279                                 

Gene name
asnO1
Definition
glutamine-hydrolyzing asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bal00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BACI_c11910 (asnO1)
Enzymes [BR:bal01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BACI_c11910 (asnO1)
Peptidases [BR:bal01002]
 Cysteine Peptidases
  Family C44
   BACI_c11910 (asnO1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1119924..1121270
Genome map
AA seq 448 aa AA seqDB search
MAHPDVKAEVTLEGLSEIFGLGPSRTPGHGIYAGIKELRPGHAMTFSKNGLCIWRYWNVE
SKKHEDSFEETVEKTRFLLQDAITRQLVSDVPLCTFLSGGVDSSAITAIAAKEYERSGKG
QLHTYSVDYEDNDKYFKVNALQPNSDAPFIHLMTETFQTIHHRCVISNEQLAQYLTEAVL
VRDLPGMADIDSSLLWFCREIKQDFVVGLSGECADEIFGGYPWFYREDDLQSSAFPWMRS
TEAREQLLKKEWRNKLNLQQYVQQRYEESIQEVPILEGESPLEAKRRQLFYLNMVWFMTT
LLDRKDRMSMGASLEVRVPFADHRLVEYAWNIPWEMKMYKNREKGLLRKALEGLLPNDIL
YRKKSPYPKTHNPHYTKAVTVWIQDLLTDKGSILHELFDKEQLSGLIESGGSAFQTPWYG
QLMTGPQLLAHLAQIHVWFKEYGVNIKE
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
ttggcgcatccagatgtgaaggcggaagtgacgttagaaggattatctgaaatatttggc
cttggaccatctagaacgcctggtcacggtatttatgctggtataaaagaattacgtcca
ggtcatgcgatgacattttcgaagaacggtttatgtatatggagatattggaatgtagaa
agtaaaaagcatgaagattcctttgaagaaacagtagaaaaaacacgctttttattacaa
gatgcgattacaaggcagctcgtttctgatgtaccattatgcacttttttatcaggcggt
gtagattcaagcgctataacagcaattgctgcgaaagaatacgaaagatcgggaaaaggt
caattacacacgtattcggttgattacgaagataatgataaatactttaaagtaaatgcg
cttcagccaaattcagatgcaccatttattcatttgatgactgagacgtttcaaacgatc
catcatcgctgcgtcatttcaaatgaacaattagcgcagtatttaacagaagcagtactc
gttcgtgatttgcctggtatggcagatatcgattcgtcattattatggttttgccgcgaa
attaaacaagattttgtcgttggtttatctggggaatgtgcagatgaaatatttggtggt
tatccatggttttatagagaagatgatttacaatcgagtgcatttccgtggatgcgttct
acagaagcgcgtgaacaattgctaaagaaagaatggagaaataaattaaatttacaacaa
tatgtacagcagcgctatgaagaatcgattcaagaagttcctattttagaaggagaaagt
ccgctagaagcaaaaagacgccaattattttatttaaacatggtatggtttatgacaaca
ttattagacagaaaagaccgcatgagtatgggggcaagcttagaagtacgcgttccgttt
gcggatcaccggcttgtcgaatatgcgtggaatattccttgggaaatgaaaatgtataaa
aaccgcgaaaaaggtctattgcgtaaagcgttagaagggttacttccaaatgacatctta
tatagaaagaagagcccatatccgaaaacacataatccgcactatacgaaagcagtaaca
gtatggatacaagatttattaacggataaaggctcaattttacacgagctatttgataaa
gaacagctgagtggattaattgagtcaggcggcagtgcattccaaacgccatggtatggt
caattaatgactgggccacagcttttagctcatttagcgcaaattcatgtttggtttaaa
gaatatggagtaaatattaaagaatag

DBGET integrated database retrieval system