KEGG   Bacillus cereus biovar anthracis CI: BACI_c12790Help
Entry
BACI_c12790       CDS       T01279                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BACI_c12790 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BACI_c12790 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BACI_c12790 (trpB)
Enzymes [BR:bal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BACI_c12790 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1201607..1202800
Genome map
AA seq 397 aa AA seqDB search
MNYAYPDEKGHYGIYGGRYVPETLMQSVLELEEAYKEAMQDEAFQKELNHYLKTYVGRET
PLYFAENMTKYCGGAKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGAGQHG
VATATVCALLGLECVIFMGEEDVRRQKLNVFRMELLGAKVESVAAGSGTLKDAVNEALRY
WVSHVHDTHYIMGSVLGPHPFPQIVRDFQSVIGNETKKQYEELEGKLPEAVVACIGGGSN
AMGMFYPFVHDEEVALYGVEAAGKGVHTEKHAATLTKGSVGVLHGSMMYLLQNEEGQIQE
AHSISAGLDYPGVGPEHSLLKDIGRVSYHSITDDEALEAFQLLTKKEGIIPALESSHAVA
YALKLAPQMKEDEGLVICLSGRGDKDVESIKRYMEEV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgcatatccagatgaaaaaggtcactacggtatatacggaggacgatacgtt
ccagaaacgttaatgcaatctgtactagaactagaagaagcatataaagaagcgatgcaa
gatgaggcgtttcaaaaggaattaaatcattatttaaaaacgtatgtcggaagagaaaca
ccgctttatttcgctgagaatatgacgaagtattgcggaggtgcaaagatttatttaaaa
cgtgaagatttgaatcatacaggagctcacaaaattaacaatacaattggtcaggcgctt
cttgcggtgcgaatgggcaagaaaaaagttgtcgctgaaacaggagctggacaacacgga
gtcgcaacagctactgtatgtgcccttctcggtttagaatgcgtcatttttatgggagaa
gaagatgtaagacgtcaaaaattaaatgtgttccgaatggaattactcggagcgaaagta
gaaagtgtagcagcaggtagcggtacattaaaagatgcggtaaacgaggcgcttcgctac
tgggtttcacatgtgcatgatacgcactacattatgggatctgttctcggaccgcatcca
ttcccgcaaattgtccgtgatttccaaagtgtaattgggaatgagacgaagaaacaatat
gaagaattagaagggaagttaccagaagcagtcgttgcttgtattggtggtgggagtaac
gcaatgggaatgttttatccgttcgtacacgatgaagaagttgctctttacggcgtagaa
gcagctggaaaaggtgttcatacagaaaagcatgcagcaactttaacgaaaggaagcgtc
ggtgttttacacggatcaatgatgtatcttctgcaaaatgaagaaggtcaaattcaagaa
gcgcactctatttcagcagggcttgattacccgggagttggtccagaacatagcttgcta
aaagatattggccgcgtttcttatcattccattactgatgatgaggcgttagaagcgttt
cagttattaacaaaaaaagaagggattatcccggcgttagaaagctcgcatgctgttgca
tacgcattgaaattagcgccgcaaatgaaggaagacgaaggacttgtcatttgtttatcc
ggccgtggtgataaagatgtagagagtataaaacgttatatggaagaggtgtaa

DBGET integrated database retrieval system