KEGG   Bacillus cereus biovar anthracis CI: BACI_c12790Help
Entry
BACI_c12790       CDS       T01279                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
bal00260  Glycine, serine and threonine metabolism
bal00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bal01100  Metabolic pathways
bal01110  Biosynthesis of secondary metabolites
bal01130  Biosynthesis of antibiotics
bal01230  Biosynthesis of amino acids
Module
bal_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bal00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BACI_c12790 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BACI_c12790 (trpB)
Enzymes [BR:bal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BACI_c12790 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADK03957
UniProt: D8H635
Position
1201607..1202800
Genome map
AA seq 397 aa AA seqDB search
MNYAYPDEKGHYGIYGGRYVPETLMQSVLELEEAYKEAMQDEAFQKELNHYLKTYVGRET
PLYFAENMTKYCGGAKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGAGQHG
VATATVCALLGLECVIFMGEEDVRRQKLNVFRMELLGAKVESVAAGSGTLKDAVNEALRY
WVSHVHDTHYIMGSVLGPHPFPQIVRDFQSVIGNETKKQYEELEGKLPEAVVACIGGGSN
AMGMFYPFVHDEEVALYGVEAAGKGVHTEKHAATLTKGSVGVLHGSMMYLLQNEEGQIQE
AHSISAGLDYPGVGPEHSLLKDIGRVSYHSITDDEALEAFQLLTKKEGIIPALESSHAVA
YALKLAPQMKEDEGLVICLSGRGDKDVESIKRYMEEV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgcatatccagatgaaaaaggtcactacggtatatacggaggacgatacgtt
ccagaaacgttaatgcaatctgtactagaactagaagaagcatataaagaagcgatgcaa
gatgaggcgtttcaaaaggaattaaatcattatttaaaaacgtatgtcggaagagaaaca
ccgctttatttcgctgagaatatgacgaagtattgcggaggtgcaaagatttatttaaaa
cgtgaagatttgaatcatacaggagctcacaaaattaacaatacaattggtcaggcgctt
cttgcggtgcgaatgggcaagaaaaaagttgtcgctgaaacaggagctggacaacacgga
gtcgcaacagctactgtatgtgcccttctcggtttagaatgcgtcatttttatgggagaa
gaagatgtaagacgtcaaaaattaaatgtgttccgaatggaattactcggagcgaaagta
gaaagtgtagcagcaggtagcggtacattaaaagatgcggtaaacgaggcgcttcgctac
tgggtttcacatgtgcatgatacgcactacattatgggatctgttctcggaccgcatcca
ttcccgcaaattgtccgtgatttccaaagtgtaattgggaatgagacgaagaaacaatat
gaagaattagaagggaagttaccagaagcagtcgttgcttgtattggtggtgggagtaac
gcaatgggaatgttttatccgttcgtacacgatgaagaagttgctctttacggcgtagaa
gcagctggaaaaggtgttcatacagaaaagcatgcagcaactttaacgaaaggaagcgtc
ggtgttttacacggatcaatgatgtatcttctgcaaaatgaagaaggtcaaattcaagaa
gcgcactctatttcagcagggcttgattacccgggagttggtccagaacatagcttgcta
aaagatattggccgcgtttcttatcattccattactgatgatgaggcgttagaagcgttt
cagttattaacaaaaaaagaagggattatcccggcgttagaaagctcgcatgctgttgca
tacgcattgaaattagcgccgcaaatgaaggaagacgaaggacttgtcatttgtttatcc
ggccgtggtgataaagatgtagagagtataaaacgttatatggaagaggtgtaa

DBGET integrated database retrieval system