KEGG   Bacillus cereus biovar anthracis CI: BACI_c22060Help
Entry
BACI_c22060       CDS       T01279                                 

Gene name
asnB
Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bal00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2067668..2069569
Genome map
AA seq 633 aa AA seqDB search
MCGFVGCLCENPREFSETEKHQFENMNTMIFHRGPDDEGYFRDEHVQFGFRRLSIIDLEA
GHQPLTYENDRYVIIFNGEIYNYVELREMLLEKGATFATQSDTEVIIALYAHMKEKCVDY
LRGMFAFMIWDREEKKLFGARDHFGIKPLYIAQQGDTTFFASEKKSIMHMMEDKGVNPTS
LQHYFTYQYGPEPETLTIDVNKIEPGHYFVKEIGKEMEIHRYWKPYFNASSATKEEHIQA
IRDVLYDSVKVHMRSDVPVGSFLSGGIDSSIIASIAREMNPNLLTFSVGFEQRGFSEVDV
AKETAEKLGVKNHNVFISAKEFMDEFPKIIWHMDDPLADPAAVPLYFVAKEARKHVTVVL
SGEGADELFGGYNIYREPNSLKMFSYIPSPGKSVLKALSGALKEGFKGKSFLERGCTPIE
ERYYGNAKIFREEEKAELMKYYNESVNYMDITKPLYNEIKDYDDVSKMQYIDMFTWLRGD
ILLKADKMTMANSLELRVPFLDKEVFDVASKIPTEFKIANGTTKAILREAARGIVPDHVL
DRKKLGFPVPIRHWLKDEMHDWAINIINESKTEHLIDKQYVLNLLEAHCADKGDYSRKIW
TVLAFMVWHQIYVEHKYDTNKFHEETKRAYSLV
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggttttgtaggatgtttatgtgaaaaccctagagagttttcagaaacagaaaaa
catcaatttgaaaatatgaacacgatgattttccaccgtggtccagatgacgaaggatat
tttcgtgatgaacatgtacaatttggcttccgccgtttaagtatcattgacttagaggca
ggacatcagccgctaacttatgaaaatgatcgatatgtaattatttttaatggtgaaatt
tacaactatgtagaattacgtgaaatgttacttgaaaaaggtgcaacgtttgcaacgcaa
tctgatacagaagttatcattgcattgtatgcacatatgaaagaaaaatgtgtagactac
cttcgtggtatgtttgcatttatgatttgggatcgtgaagagaagaaacttttcggagca
cgtgatcacttcggtattaaacctttatacatcgcacaacaaggtgatactacattcttc
gcatctgagaagaaaagtattatgcatatgatggaagataaaggcgttaatccaacgtca
ctacaacattactttacgtatcaatatggtccagagccagaaacattaacaattgatgtt
aataaaatcgagcctggtcattatttcgtaaaagaaatcggtaaagagatggaaatccat
cgctactggaaaccttatttcaatgcttcaagtgcaacgaaagaggaacatatccaagcg
attcgtgatgtgttatatgattcagtaaaagtgcatatgcgcagtgatgtaccagtaggt
tcattcttatctggtggtatcgattcatctattatcgcttctattgcaagagaaatgaat
ccaaatcttttaacattctctgtgggttttgagcaacgtggtttcagtgaagttgatgtt
gcgaaagaaactgctgagaaattaggcgttaaaaaccataacgtattcatttcagcgaaa
gagtttatggatgagttcccaaaaatcatttggcatatggatgatcctttagcagatccg
gcagctgtaccattgtacttcgttgcaaaagaagcacgtaaacatgtaacagttgttctt
tcaggtgaaggtgcagacgagctatttggtggttataacatttaccgtgagccaaactca
ctgaaaatgttctcttacattcctagcccaggtaagagcgttctaaaagcattaagtggt
gctcttaaagaaggctttaaaggaaagagcttcctagagcgtggatgtacgccaattgaa
gagcgttactatggaaacgcgaaaatcttccgtgaagaagagaaagctgaattaatgaag
tattacaatgaaagtgttaactatatggatatcacgaaaccattgtataacgaaattaaa
gattatgatgatgtaagcaaaatgcagtacattgacatgttcacatggttacgcggtgac
attttattaaaagctgataaaatgacaatggcgaattcattagaacttcgtgtaccgttc
ttagataaagaagtattcgatgttgcatctaaaattccaactgaatttaagattgctaat
ggaactacgaaagctattttacgtgaagcagcacgcggaatcgttccagatcacgtatta
gatcgtaaaaaacttggattcccagtaccaattcgtcactggctaaaagacgaaatgcat
gattgggctataaatattataaacgaaagtaagacagagcatttaatcgacaaacagtat
gtattaaacttactggaagcacattgtgcggataaaggcgattatagccgtaaaatttgg
actgtacttgcgtttatggtatggcatcaaatttatgttgagcataaatacgatacgaat
aagttccacgaagaaacgaaacgtgcgtatagcttagtttaa

DBGET integrated database retrieval system