KEGG   Bacillus cereus biovar anthracis CI: BACI_c24600Help
Entry
BACI_c24600       CDS       T01279                                 

Gene name
gpm1
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BACI_c24600 (gpm1)
   01230 Biosynthesis of amino acids
    BACI_c24600 (gpm1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BACI_c24600 (gpm1)
  Energy metabolism
   00680 Methane metabolism
    BACI_c24600 (gpm1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BACI_c24600 (gpm1)
Enzymes [BR:bal01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BACI_c24600 (gpm1)
Exosome [BR:bal04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BACI_c24600 (gpm1)
  Exosomal proteins of melanoma cells
   BACI_c24600 (gpm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2314652..2315389
Genome map
AA seq 245 aa AA seqDB search
MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLSEAREAGAILKKNGYTFDVAYTSVLKR
AIRTLWIVLHEMDLAWVPVHKCWKLNERHYGALQGLNKDETAQKYGEEQVHIWRRSIDVR
PPALTEDDPRYEMNDPRYKALKKGEFPLTECLVDTEKRVLAYWHSEIAPKLKNGNKVIIS
SHGNTIRSLVKYLDNLSSDGVVSLNIPTSIPLVYELDENLRPIRHYYLSMDGEVPEGEIP
KHISF
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacttgtacttattcgtcacggacagagtttatggaatcttgaaaatcgtttt
actggatggacagatgtagatttatcagagaatggattaagtgaagcgagagaagcagga
gcgatattaaagaaaaacggatatacttttgatgtagcttatacatctgtattaaaacga
gcaattcggacgttatggattgtacttcatgagatggatcttgcctgggtgccagtacat
aaatgttggaagctaaatgaaagacattatggtgcattgcaagggttgaataaagatgaa
actgcgcaaaaatatggtgaggagcaagttcatatttggagaagaagtattgatgtaaga
ccacctgctcttactgaagatgatcccaggtatgaaatgaatgatccaagatataaagca
ctgaaaaaaggtgagtttccattgacagaatgtttagtggatacggagaaaagagtactt
gcttattggcattcagaaattgcgccgaaattaaagaatggtaacaaagtaatcatttca
tcacatggtaacacaattcgttcgttagtaaaatatttagataatctttcaagtgatggt
gttgtttcactaaatattccaacgagtataccgctcgtgtatgaattagacgaaaattta
cgtccgattcgccattattacttaagtatggatggagaagtacctgaaggggaaattccg
aaacatatttctttttaa

DBGET integrated database retrieval system