KEGG   Bacillus cereus biovar anthracis CI: BACI_c25230Help
Entry
BACI_c25230       CDS       T01279                                 

Gene name
acs
Definition
(GenBank) acetate-CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
bal00010  Glycolysis / Gluconeogenesis
bal00620  Pyruvate metabolism
bal00640  Propanoate metabolism
bal00680  Methane metabolism
bal01100  Metabolic pathways
bal01110  Biosynthesis of secondary metabolites
bal01120  Microbial metabolism in diverse environments
bal01130  Biosynthesis of antibiotics
bal01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BACI_c25230 (acs)
   00620 Pyruvate metabolism
    BACI_c25230 (acs)
   00640 Propanoate metabolism
    BACI_c25230 (acs)
  Energy metabolism
   00680 Methane metabolism
    BACI_c25230 (acs)
Enzymes [BR:bal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BACI_c25230 (acs)
Lipid biosynthesis proteins [BR:bal01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BACI_c25230 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADK05162
UniProt: D8GZ11
Position
2382232..2384172
Genome map
AA seq 646 aa AA seqDB search
MKQAVWFPTEEYKEKTRLYGWMKSLGYEDYETFYNKSIEETAWFWGEAEKAVGYQWMKPY
TEVLDLQNGTPFAQWYNGGTCNVVESVLSRWLADDETRMQPALQYEGENGTSKSFTYEEL
DSWVSRVANGLKHAGIEKGDRVTIYMPMIPETVVAMLAVMKIGAITSPIFSGFASDAVMT
RVQAAGSKMIITADGFSRRGKIVSLKDEVDKACEHCPTVEKVVIVRHAGNDFTPHDYDFS
WSTLEKEKPFVHAEEMHSDDPLMLIYTSGTTGKPKGTVHTHAGFPLKAAFDAGFGMNIKQ
GDRVLWVTDMGWMMGPFLLFGSLINGATMVMYEGVPDFPEADRLWETVDKYEITHLGISP
TLIRALMAKGDEYVNKHSLKSLEVFASTGEPWNPDPWMWLFETVGKSNVPICNYSGGTEI
SGGIFGNVLIKPIAPISFNASLPGMAAVVLDDQGNPIRDEVGELCLEKPWVGMTKSFWED
DERYVNTYWSRFENKWVHGDWVVYDGEQYIITGRSDDTLNIAGKRIGPAEYESILVKHND
VIEAAAIGVPDDVKGEVCHCFVVLRDNVTFTGELKKELMSLVNSHIGKALCPKDIHVVED
LPKTRNSKVMRRVIKAAYLGKELGDLSSLVNPEVVPFIQGLQSSKL
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacaagcagtttggtttccaacagaagagtataaagaaaaaacacgcttatatggt
tggatgaaatcattggggtatgaagattatgaaacgttttataataaatctattgaagaa
acagcttggttttggggagaagctgagaaagcggttggctatcaatggatgaaaccttat
acagaagtgttagacctgcaaaatggtacgccgtttgcacagtggtataatggcggaaca
tgtaacgttgtagaatcagtgttatcacgctggcttgcagatgatgaaacaagaatgcaa
ccagcacttcagtatgaaggagaaaatggaacttcaaaatcatttacatatgaagaactt
gatagctgggtaagtcgcgttgcaaatggtttgaaacatgcgggtattgaaaaaggcgac
cgagtaacaatttatatgccaatgattccagaaacagttgttgcgatgctagctgtaatg
aaaatcggagcaattacttcaccaatattctcaggatttgcgtctgatgcagtcatgaca
cgcgtgcaagcagcaggatcaaagatgatcattactgcagatggtttttcacgccgaggt
aagattgtttcattaaaagatgaagtagataaagcttgtgagcattgtccaactgttgaa
aaagtcgttatcgtgcgccacgcaggaaatgattttacaccgcatgattatgatttctca
tggagtacgttagaaaaagaaaagccatttgtacatgctgaagaaatgcatagtgacgat
ccgttaatgctcatttatacatcaggtacaacaggaaaaccgaaagggaccgtgcacact
catgctggtttccctttgaaagcagcatttgatgcagggtttgggatgaatataaaacaa
ggcgaccgcgtattatgggtaactgatatgggctggatgatgggaccatttttactattt
ggctctctcattaatggagcaacgatggttatgtatgaaggtgttccggacttcccagaa
gcagatcgtttatgggagacagttgataaatatgaaattacacatctcggtatatcacca
acattaattcgtgcgttaatggcaaaaggtgatgagtatgtaaataaacattcgcttaag
agtttagaagtatttgcctcaacaggcgagccttggaatccagacccttggatgtggtta
tttgaaacggttggaaaaagtaatgtgccaatttgtaactattcaggcggaactgaaatt
tcaggtgggatttttgggaacgtccttattaaaccaattgcaccgattagctttaatgct
tctttaccagggatggcggcggttgtgctcgatgatcaaggtaatccaattcgcgatgaa
gttggagaattatgtttagagaaaccttgggttggtatgacgaaaagtttctgggaagac
gatgagcgttatgtgaacacatattggtcacgttttgaaaataaatgggttcatggtgac
tgggtggtttatgatggtgagcaatatattattacaggacgctcagatgatacgctaaac
attgctggaaaacgcattggacctgctgaatatgaatctattcttgtgaagcataatgat
gtcatagaagctgccgcgattggtgtaccagatgatgtaaaaggtgaagtttgtcattgt
tttgtagtattaagagataatgtaacatttacaggagaattaaagaaagaattaatgagt
ttagtaaactctcatattggaaaagcattatgtccaaaagatattcacgttgtagaagat
ttaccgaaaacgcgtaattctaaagtaatgcgacgtgtcattaaagctgcttatctaggg
aaagaattaggtgatttatcatcacttgtaaaccctgaagtagtgccatttattcaggga
ttgcagtctagtaaattataa

DBGET integrated database retrieval system