KEGG   Bacillus cereus biovar anthracis CI: BACI_c25660Help
Entry
BACI_c25660       CDS       T01279                                 

Gene name
murE1
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bal00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BACI_c25660 (murE1)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BACI_c25660 (murE1)
Enzymes [BR:bal01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     BACI_c25660 (murE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2423008..2424486
Genome map
AA seq 492 aa AA seqDB search
MKLKELANLLLVKETIGDMNVKITGLEIDSRKITNGNLFICVSGINGFLEDRHQFVEDAV
KNGAVALIVERDVNIEIPKIIVKDARYAMAVIASHFYDYPSNKMKLIGITGTNGKTTTSY
LLEKIFSDYGYHTGLMGNNGVKVGSKWYPTDINTQEPPTLQRNLQMMKNRNADYCVMEVT
SQGLHMERVKGCNFKIAVFTNLTQDHLDYHGTFDEYKHVKGLLFARLGNDLSTTEKKIAV
LNADDPSVEYFKKITSAEVITYGIHNGADVQAKNITLSPKGIHFLVSSFNGEIEVSLNLV
GRFNVYNALAAITVAMVEGIPLTNICDSFSNLKSIEGRMEIIDENQDFLVIVDYAHTPDA
LENVLSTISEFSKGKVITVFGCGGDRDAKKRSIMGGIAGSYSDFVFITSDNPRSEDPQAI
MKDIEKGFLQNNNLNYKVEVDRELAINHAINMASSNDIVLIAGKGHETYQILKDSTIHFD
DKEKARQAIINK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactaaaagagctggcgaatttgttattggttaaagaaactattggcgatatgaat
gtaaaaattacgggattagaaatagattctagaaagataactaatggaaacctatttata
tgtgtatcaggtatcaatggttttcttgaagatcgacatcaatttgttgaagatgcagtg
aaaaatggtgctgtagcactaattgtagaaagagatgtaaatattgagatacctaaaata
attgttaaagatgctagatatgctatggcagttattgcgtcacatttctatgattatcca
tctaataagatgaagttaattggaattacaggaacaaatgggaaaacaactacttcctat
ttacttgaaaaaatcttcagtgattatggatatcacacggggctcatggggaataacgga
gtcaaagttggttcaaaatggtatcctactgatattaatacgcaagaacctccaacactt
caacggaatttgcaaatgatgaaaaatcgaaatgcagattattgtgttatggaagttacg
tcacaaggtttacatatggaaagagttaaagggtgtaactttaaaatagctgttttcaca
aatttaacgcaagatcatttagattatcatggaacatttgatgaatataagcatgtaaaa
ggtcttctttttgcaaggttaggaaatgatttatctactacagagaaaaaaatagccgtt
ttgaatgcagatgatccatcggtagaatactttaaaaaaattacttcagctgaggttatt
acatatggaatacataatggagcagatgttcaagcgaagaacataactttaagcccaaaa
ggaattcattttttagtttcgtcctttaatggagaaatagaggttagccttaatcttgta
ggtcgttttaatgtttataatgcattagcagcaataacagttgcaatggttgaaggtatt
ccgcttacaaacatttgtgatagcttttctaacttaaagagtattgaaggtagaatggaa
atcatagatgaaaatcaagattttcttgtaatagtggactatgctcatacaccggatgcg
ttagaaaatgttctctctacaattagcgagttttcaaaaggtaaagttattactgttttc
ggttgtggtggggatagagacgcaaaaaaacgatctataatgggcggaattgctggaagt
tatagcgattttgtttttattacttctgacaatccacgttcggaagatccgcaggcaata
atgaaagatattgaaaaaggatttttgcaaaataataatttgaattataaagtagaagta
gatcgtgaacttgcaataaatcacgcaataaatatggcatcttctaatgatattgttttg
attgcagggaaagggcatgaaacgtatcaaattttaaaagattcaactattcattttgat
gataaagaaaaagctcgacaagcaattattaataaatga

DBGET integrated database retrieval system