KEGG   Bacillus cereus biovar anthracis CI: BACI_c27360Help
Entry
BACI_c27360       CDS       T01279                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
bal00010  Glycolysis / Gluconeogenesis
bal00020  Citrate cycle (TCA cycle)
bal00620  Pyruvate metabolism
bal01100  Metabolic pathways
bal01110  Biosynthesis of secondary metabolites
bal01120  Microbial metabolism in diverse environments
bal01130  Biosynthesis of antibiotics
bal01200  Carbon metabolism
Module
bal_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BACI_c27360
   00020 Citrate cycle (TCA cycle)
    BACI_c27360
   00620 Pyruvate metabolism
    BACI_c27360
Enzymes [BR:bal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BACI_c27360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N GCV_H
Motif
Other DBs
NCBI-ProteinID: ADK05367
UniProt: D8H0B8
Position
complement(2576411..2577613)
Genome map
AA seq 400 aa AA seqDB search
MAVEVVMPKLGMAMKEGIITSWNIKAGDNVAKGELIASINSEKIETEIEAPADGTVLDIA
VSEDEGVPPGTVICYIGKPNEKVEVHESTKVEEELTASEVPQNVQHPEPLGKEVTNKQRI
KISPVAKKVAKTENLDIKSLLGTGPGGRITKVDVLKALEERVAVPEVLEQEESKVIPVTG
MRKAIANRMHASLQNSAQLTLTMKVDVTDLVALHKEIAEVVQKRYDNKLTITDFVSRAVV
LALGDHKEMNSAYIDDAIHQFEHVHLGMAVALEKGLVVPAIRFANNLSLVELSKEIKNVA
QKARAGNLNSDDMQGTTFTISNLGSFGIEYFTPVLNTPETGILGVGAIEYVPVYKGKKLK
KGSMLPLSLTFDHRVLDGAPAAAFLRTIKRYLEEPVTILL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggctgtagaagttgtaatgccgaagttagggatggcgatgaaagagggtattattacg
agctggaatattaaagcgggtgataatgtggcaaaaggagaattaattgccagtattaac
tcggaaaaaattgaaacggaaatagaagcaccagctgatggaactgttcttgatatagct
gtaagtgaagatgagggggttccacctggcactgtaatttgctacattggtaaaccgaat
gaaaaagtagaggtacatgaaagcacaaaggttgaggaagaactgacagcgagtgaagta
ccacaaaatgtacaacatccagaaccgttagggaaagaagttacgaataaacaaagaatc
aaaatatctcctgtagcgaagaaggttgcgaaaactgaaaatcttgatattaaatcatta
cttggtaccggtccaggtggaagaattacaaaggtagatgtattaaaggcgcttgaagaa
agagtagcagttccagaagtacttgaacaagaagaaagtaaagtaattcctgttactggt
atgcggaaagcaatcgcaaaccgtatgcatgcaagcttacaaaatagtgcacaattaaca
ttaacgatgaaagtagatgtgacagatttagttgctttacataaagaaatagcagaagtt
gtacaaaaacggtacgataacaaattaaccattacggatttcgtttctcgagctgttgta
ttagcgcttggggatcataaagaaatgaacagcgcttatatagatgatgcaattcatcaa
tttgaacatgttcatttaggtatggcagtcgcattagaaaaaggattagtcgttccagct
attcgcttcgcaaataatctctcattagtagagttatctaaagagattaagaatgtggca
caaaaggcaagagcaggcaatttaaatagtgatgatatgcaaggaacaacatttacaatt
agtaatttaggaagcttcggtattgaatattttacaccagtattaaacacaccagaaact
ggtattttaggtgtaggtgcaattgaatatgttcctgtatataaaggaaaaaaattaaaa
aaaggaagtatgttacctttaagtttaacattcgatcatcgtgtactagacggtgcacca
gcagctgcatttttacgcacaattaaacgctatttagaagaacctgtaacaattctttta
taa

DBGET integrated database retrieval system