KEGG   Bacillus cereus biovar anthracis CI: BACI_c29470Help
Entry
BACI_c29470       CDS       T01279                                 

Gene name
proB
Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BACI_c29470 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BACI_c29470 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BACI_c29470 (proB)
Enzymes [BR:bal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BACI_c29470 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2766984..2768087)
Genome map
AA seq 367 aa AA seqDB search
MKKQRIVVKIGSSSLADSHGGISKEQLSDHVAALARLKEEGHEVLLITSGAVAAGFSALG
YPSRPVTIKGKQAAAAVGQSLLMQAYTEEFRKYGIVTAQLLLTRSDFSRKEQYSNAYATL
GELLNRSALPIINENDSISLEELTFGDNDMLSALVSGLVSADMLMIFTDVNGLYDKNPQK
NEDAKKYYFLPEVTEEIASLAGDAGSKLGTGGMKSKIDAAKTALSLGVSVFIGTGRGQEK
FVDVLKGKGDGTYVGNAPQKEMKMNKQWIALHSVVSGQIEIDAGAATAIIQHGKSLLPAG
VTNVSGFFQVGEVVEVMTQQGRVIGKGQCTYSAEELRDVKGMQSQQIQARGERHNYEVIH
RDYWVSF
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaacaacgaattgttgtaaagattgggagcagttctttggcggatagtcacgga
ggcatttctaaagaacaactttcagatcacgttgcggcattagctcgattgaaagaggaa
gggcatgaagtgttgttaattacatctggggccgtcgcagcaggtttttcagctctaggg
taccctagtagacctgtaacaattaaaggaaaacaggctgcagcagctgtcggacaaagt
ttgttaatgcaggcgtacacggaggaatttcgtaaatacggtatcgttactgcgcaacta
ttgctgacgagaagtgatttttctagaaaagaacaatatagtaacgcttacgctacgtta
ggagagttactaaaccgttctgctcttccaatcattaatgaaaatgattccatttcttta
gaggagctaacgttcggtgataatgatatgctgtcagctttagtaagcggacttgtttcg
gcggatatgctgatgatttttacagatgtgaacggtttatatgataaaaatcctcagaaa
aatgaggatgcgaaaaaatattatttccttcctgaagttacggaagaaatcgcttctctt
gcaggagatgctggttcaaaacttgggactggcggtatgaaatcaaaaattgatgctgcg
aagacagcactttctcttggcgtgagtgtatttatcggaacaggacgtggacaagagaag
tttgtagatgttttgaaggggaaaggtgatggtacgtatgtcggaaatgcccctcaaaaa
gaaatgaagatgaataagcaatggatcgctttgcattcggttgttagcggacaaattgaa
atagacgctggagcagctacagctatcattcagcatggcaagagtcttcttcctgctggt
gttacaaatgtttcagggtttttccaagtgggcgaagtcgtagaagtaatgacgcaacaa
ggacgcgtgattggaaaaggacaatgcacatatagtgcagaggagctaagggatgtaaaa
ggtatgcaaagccaacagattcaagcaagaggcgaaagacataattatgaagtcattcat
agagattattgggtttcattttaa

DBGET integrated database retrieval system