KEGG   Bacillus cereus biovar anthracis CI: BACI_c39270Help
Entry
BACI_c39270       CDS       T01279                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
bal00010  Glycolysis / Gluconeogenesis
bal00020  Citrate cycle (TCA cycle)
bal00620  Pyruvate metabolism
bal01100  Metabolic pathways
bal01110  Biosynthesis of secondary metabolites
bal01120  Microbial metabolism in diverse environments
bal01130  Biosynthesis of antibiotics
bal01200  Carbon metabolism
Module
bal_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BACI_c39270 (pdhC)
   00020 Citrate cycle (TCA cycle)
    BACI_c39270 (pdhC)
   00620 Pyruvate metabolism
    BACI_c39270 (pdhC)
Enzymes [BR:bal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BACI_c39270 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H NUP50
Motif
Other DBs
NCBI-ProteinID: ADK06534
UniProt: D8H8V1
Position
complement(3735272..3736561)
Genome map
AA seq 429 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFIKPGDEVNEDDVLLEVQNDKAVVEIPSPVKGKVLEVL
VEEGTVAVVGDTLIKFDAPGYENLKFKGDDHDEAPKAEEAKEEAPKAEATPAATAEVVNE
RVIAMPSVRKYARENGVDIHKVAGSGKNGRIVKADIDAFANGGQAVAATEAPAAVEATPA
AAKEEAPKAQPIPAGEYPETREKMSGIRKAIAKAMVNSKHTAPHVTLMDEVDVTELVAHR
KKFKAVAADKGIKLTYLPYVVKALTSALREYPMLNTSLDDASQEVVHKHYFNIGIAADTD
KGLLVPVVKDTDRKSIFTISNEINDLAGKAREGRLAPAEMKGASCTITNIGSAGGQWFTP
VINHPEVAILGIGRIAEKPVVKNGEIVAAPVLALSLSFDHRLIDGATAQKALNQIKRLLN
DPQLLVMEA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaactaccagatatcggtgaaggtatccacgaaggtgaaatcgta
aaatggtttattaaaccaggcgacgaagtaaacgaagacgacgtacttcttgaagtacaa
aatgataaagcagtagtagaaattccttctcctgttaaaggtaaagtacttgaagtactt
gtagaagaaggtacggttgcagtagttggagatacattaattaaatttgatgctccagga
tacgaaaaccttaaatttaaaggcgacgatcatgacgaagctcctaaagctgaagaagca
aaagaagaagctcctaaagctgaagctactccagcagcaactgcagaagtagtaaatgag
cgcgtaatcgctatgccatctgttcgtaaatatgctcgtgaaaacggcgtagacattcat
aaagtagctggttctggtaagaacggtcgtatcgtaaaagctgacatcgatgcatttgca
aatggtggacaagcagtagcagcaactgaggctccagcagcagtagaagctactccagca
gcagcgaaagaagaagcaccaaaagcacaaccaatcccagctggtgaatatccagaaact
cgtgagaaaatgagtggtatccgtaaagcaattgcgaaagcaatggttaactctaaacat
acagctcctcacgtaacattaatggatgaagtagatgtaactgaacttgttgctcaccgt
aagaagttcaaagctgtggcagctgacaaaggtattaaattaacttaccttccatacgtt
gttaaagctttaacatctgcattacgtgaatacccaatgttaaacacttctttagatgat
gcttctcaagaagtagttcataaacattacttcaacatcggtatcgcagctgatacagac
aaaggtctattagtaccagttgttaaagatacagatcgcaagtctatcttcacaatttct
aacgagatcaatgatcttgctggtaaagcacgtgaaggtcgtttagctcctgctgaaatg
aaaggcgcttcttgcacaattacaaacattggttctgcaggtggacaatggttcactcca
gttatcaaccacccagaagtagcaatccttggtatcggccgtatcgctgagaaaccagtt
gtgaaaaacggtgagatcgttgcagctccagtattagcattatctctaagctttgaccat
cgtttaattgacggcgcaactgctcaaaaagcattaaaccaaattaaacgtctattgaat
gacccacaattattagtaatggaggcgtaa

DBGET integrated database retrieval system