KEGG   Bacillus cereus biovar anthracis CI: BACI_c40080Help
Entry
BACI_c40080       CDS       T01279                                 

Definition
dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:bal00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3804256..3804768
Genome map
AA seq 170 aa AA seqDB search
MAQIRIHEVNTRIENEVEVSKFLQEEGVLYEKWNISKLPPHLNENYSLTDENKAEILAVF
SKEIADVSARRGYKAHDVISLSNSTPNLDELLINFQKEHHHTDDEVRFIVSGHGIFAIEG
KDGTFFDVELEPGDLISVPENARHYFTLQDDRQVVAIRIFVTTEGWVPIY
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaattcgtattcatgaagtaaatactcgcattgaaaatgaagtggaagtatct
aaatttctacaagaggaaggtgttttatatgagaaatggaatatttctaaacttcctcct
catttaaatgaaaattattcgttaacagatgaaaacaaggctgaaatattagctgtgttt
tcaaaagaaattgctgatgtttcagcgcgccgaggttataaagcacatgatgtaatttca
ctttcaaatagcacacctaaccttgacgaactattaattaatttccaaaaagaacaccat
catactgatgatgaagttcgctttattgttagtggtcatggcatctttgccattgaagga
aaagatgggacattctttgacgttgaacttgagccaggcgatctcatatctgttcctgaa
aatgcaagacattattttaccttgcaagatgatcgtcaagttgtagctattcgtattttt
gttacaactgaaggttgggttccaatctattaa

DBGET integrated database retrieval system