KEGG   Bacillus cereus biovar anthracis CI: BACI_c40080Help
Entry
BACI_c40080       CDS       T01279                                 

Definition
(GenBank) possible dioxygenase
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
bal00270  Cysteine and methionine metabolism
bal01100  Metabolic pathways
Module
bal_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bal00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BACI_c40080
Enzymes [BR:bal01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     BACI_c40080
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     BACI_c40080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 Cupin_1 AraC_binding Cupin_3 DUF3418 DUF3047
Motif
Other DBs
NCBI-ProteinID: ADK06610
UniProt: D8H9G1
Position
3804256..3804768
Genome map
AA seq 170 aa AA seqDB search
MAQIRIHEVNTRIENEVEVSKFLQEEGVLYEKWNISKLPPHLNENYSLTDENKAEILAVF
SKEIADVSARRGYKAHDVISLSNSTPNLDELLINFQKEHHHTDDEVRFIVSGHGIFAIEG
KDGTFFDVELEPGDLISVPENARHYFTLQDDRQVVAIRIFVTTEGWVPIY
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaattcgtattcatgaagtaaatactcgcattgaaaatgaagtggaagtatct
aaatttctacaagaggaaggtgttttatatgagaaatggaatatttctaaacttcctcct
catttaaatgaaaattattcgttaacagatgaaaacaaggctgaaatattagctgtgttt
tcaaaagaaattgctgatgtttcagcgcgccgaggttataaagcacatgatgtaatttca
ctttcaaatagcacacctaaccttgacgaactattaattaatttccaaaaagaacaccat
catactgatgatgaagttcgctttattgttagtggtcatggcatctttgccattgaagga
aaagatgggacattctttgacgttgaacttgagccaggcgatctcatatctgttcctgaa
aatgcaagacattattttaccttgcaagatgatcgtcaagttgtagctattcgtattttt
gttacaactgaaggttgggttccaatctattaa

DBGET integrated database retrieval system