KEGG   Bacillus cereus biovar anthracis CI: BACI_c42320Help
Entry
BACI_c42320       CDS       T01279                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BACI_c42320
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BACI_c42320
   00052 Galactose metabolism
    BACI_c42320
   00500 Starch and sucrose metabolism
    BACI_c42320
   00520 Amino sugar and nucleotide sugar metabolism
    BACI_c42320
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BACI_c42320
   00524 Butirosin and neomycin biosynthesis
    BACI_c42320
Enzymes [BR:bal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BACI_c42320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3990594..3991577)
Genome map
AA seq 327 aa AA seqDB search
MEEKWLVGVDLGGTTIKLAFINVYGEILHKWEIPTNTNEQGKHITLDVAKAIDKKLEELG
ELKSKLIGIGMGAPGPVHVASGMIYEAVNLGWKNYPLKDLLEVETGLPVVIDNDANLAAL
GEMWKGAGEGAKDLICMTFGTGVGGGVIANGEIVHGVSGAAGEIGHITVVTENAFPCNCG
KSGCLETVASATGIVRVAMQKIQETDKESILRSMLAEEGRITSKDVFEAHGQGDELAGEV
VEKVASYLGLAVANLSSTLNPEKIVIGGGVSKAGDALLEPIQRYFEQYAFSRAVKSTKLA
IATLGNDAGVIGGAWLVKKHKYEAKMI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaaatggttagttggtgttgaccttggtggtacaacgattaaattagcattt
attaatgtgtacggtgaaattttacataagtgggaaatccctacgaatacaaatgagcaa
ggaaaacatattacacttgatgtagcgaaagctattgataaaaagttagaagagttaggt
gaattaaaaagtaagttaatcggtattggtatgggagctcctggccctgtacacgtggcg
tctggaatgatttatgaagcggttaacttaggatggaaaaactatccgttaaaagattta
ttagaagtagaaacaggattacctgttgttattgataatgatgcaaatttagcggcactt
ggtgaaatgtggaagggtgctggtgaaggagcaaaagatttaatttgtatgacatttggc
actggtgttggcggcggtgtaattgctaatggcgagattgtacatggcgtaagcggtgct
gctggtgagattggacacattacagttgttacagagaatgctttcccatgtaattgcggg
aagtctggttgcctagaaactgtagcatctgcaacaggtattgtgcgtgttgctatgcag
aaaatacaagagactgataaagaaagtattctacgttctatgttagcagaagaaggacgt
attacatcaaaagacgtatttgaagcacatggacaaggtgatgaactagcaggcgaagta
gtagaaaaggtagcttcttatttaggattagctgtagcgaacctttcgagcacgttgaac
ccagagaaaatcgttattggtggaggcgtttctaaagctggagatgcactattagaacca
attcaacgttatttcgagcaatacgctttctcacgtgctgtaaagagcacgaagttagct
attgcaacacttggtaatgatgcaggtgttatcggaggagcttggcttgtaaaaaagcac
aaatacgaagcgaagatgatataa

DBGET integrated database retrieval system